SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016124 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016124
Domain Number 1 Region: 28-177
Classification Level Classification E-value
Superfamily Nucleoside diphosphate kinase, NDK 2.88e-64
Family Nucleoside diphosphate kinase, NDK 0.0000000454
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016124   Gene: ENSGGOG00000016526   Transcript: ENSGGOT00000016582
Sequence length 177
Comment pep:known_by_projection chromosome:gorGor3.1:5:32830448:32837893:-1 gene:ENSGGOG00000016526 transcript:ENSGGOT00000016582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVLLSTLGMVFQGEGPPISSCDTGTMANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRL
VGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETN
PADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE
Download sequence
Identical sequences G3RK64
ENSGGOP00000025664 ENSGGOP00000016124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]