SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016155 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016155
Domain Number 1 Region: 55-342
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.05e-38
Family beta-glycanases 0.037
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000016155
Domain Number - Region: 537-656
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0202
Family Laminin G-like module 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016155   Gene: ENSGGOG00000016552   Transcript: ENSGGOT00000016613
Sequence length 672
Comment pep:known_by_projection chromosome:gorGor3.1:14:69474442:69532475:-1 gene:ENSGGOG00000016552 transcript:ENSGGOT00000016613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEWLLSASWQRRAKAMTAAAGSAGRAAVPLLLCALLAPGGAYVLDDSDGLGREFDGIGA
VSGGGATSRLLVNYPEPYRSQILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYA
LDENYFRGYEWWLMKEAKKRNPNITLIGLPWSFPGWLGKGFDWPYVNLQLTAYYVVTWIV
GAKRYHDLDIDYIGVLRKMLNYQGLQRVKIIASDNLWESISASMLLDAELFKVVDVIGAH
YPGTHSAKDAKLTGKKLWSSEDFSTLNSDMGAGCWGRILNQNYINGYMTSTIAWNLVASY
YEQLPYGRCGLMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVAL
TDGLGNLTIIIETMSHKHSKCIRPFLPYFNVSQQFATFVLKGSFSEIPELQVWYTKLGKT
SERFLFKQLDSLWLLDSDGSFTLSLHEDELFTLTTLTTGRKGSYPLPPKSQPFPSTYKDD
FNVDYPFFSEAPNFADQTGVFEYFTNIEDPGEHHFTLRQVLNQRPITWAADASNTISIIG
DYNWTNLTIKCDVYIETPDTGGVFIAGRVNKGGILIRSARGIFFWIFANGSYRVTGDLAG
WIIYALGRVEVTAKKWYTLTLTIKGHFASGMLNDKSLWTDIPVNFPKNGWAAIGTHSFEF
AQFDNFLVEATC
Download sequence
Identical sequences ENSGGOP00000016155 ENSGGOP00000017858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]