SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016158 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016158
Domain Number 1 Region: 250-298,356-656
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.08e-90
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000262
Further Details:      
 
Domain Number 2 Region: 2-95
Classification Level Classification E-value
Superfamily RING/U-box 1.18e-27
Family Zf-UBP 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016158   Gene: ENSGGOG00000016566   Transcript: ENSGGOT00000016616
Sequence length 688
Comment pep:known_by_projection chromosome:gorGor3.1:6:43008934:43105791:-1 gene:ENSGGOG00000016566 transcript:ENSGGOT00000016616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRCKHVGRLRLAQDHSILNPQKWCCLECATTESVWACLKCSHVACGRYIEDHALKHFEE
TGHPLAMEVRDLYVFCYLCKDYVLNDNPEGDLKLLRSSLLAVRGQKQDTPVRRGRTLRSM
ASGEDVVPPHRAPQGQPQMLTALWYRRQRLLARTLRLWFEKSSRGQAKLEQRRQEEALER
KKEEARRRRREVKRRLLEELASTPPRKSARLLLHTPRDAGPAASRPAALPTSRRVPAATL
KLRRQPAMAPGVTGLRNLGNTCYMNSILQVLSHLQKFRECFLNLDPSKTEHLFPKATNGK
TQLSGKPTNSSATELSLRNDRAEACEREGFCWNGGASISRSLELIQNKEPSSKHISLCRE
LHTLFRVMWSGKWALVSPFAMLHSVWSLIPAFRGYDQQDAQEFLCELLHKVQQELESEGT
TRRILIPFSQRKLTKQVLKVVNTIFHGQLLSQVTCISCNYKSNTIEPFWDLSLEFPERYH
CIEKGFVPLNQTECLLTEMLAKFTETEALEGRIYACDQCNSKRRKSNPKPLVLSEARKQL
MIYRLPQVLRLHLKRFRWSGRNHREKIGVHVVFDQVLTMEPYCCRDMLSSLDKETFAYDL
SAVVMHHGKGFGSGHYTAYCYNTEGGFWVHCNDSKLNVCSVEEVCKTQAYILFYTQRTVQ
GNARISETHLQAQVQSSNNDEGRPQTFS
Download sequence
Identical sequences G3RK96
XP_018884788.1.27298 ENSGGOP00000016158 ENSGGOP00000016158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]