SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016163 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016163
Domain Number 1 Region: 136-370
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 6.67e-21
Family Glycerol-3-phosphate (1)-acyltransferase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016163   Gene: ENSGGOG00000016562   Transcript: ENSGGOT00000016621
Sequence length 693
Comment pep:known_by_projection chromosome:gorGor3.1:1:211437668:211476144:1 gene:ENSGGOG00000016562 transcript:ENSGGOT00000016621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRIPDPAREGSRTMESSSSSNPYFSVGPTSPSAVVLLYSKELKKWDEFEDILEERRHVSD
LKFAMKCYTPLVYKGITPCKPIDIKCSVLNSEEIHYVIKQLSKESLQSVDVLREEVSEIL
DEMSHKLRLGAIRFFAFTLSKVFKQIFSKVCVNEEGIQKLQRAIQEHPVVLLPSHRSYID
FLMLSFLLYNYDLPVPVIAAGMDFLGMKMVGELLRMSGAFFMRRTFGGNKLYWAVFSEYV
KTMLRNGYAPVEFFLEGTRSRSAKTLTPKFGLLNIVMEPFFKREVFDTYLVPISISYDKI
LEETLYVYELLGVPKPKESTTGLLKARKILSENFGSIHVYFGDPVSLRSLAAGRMSRSSY
NLVPRYIPQKQSEDMHAFVTEVAYKMELLQIENMVLSPWTLTVAVLLQNRPSMDFDALVE
KTLWLKGLTQAFGGFLIWPDNKPAEEVVQASILLHCNIASLVKDQVLLKVDSGDSEVVDG
LMFQHITLLMCSAYRNQLLNIFVRPSLVAIALQMTPGFRKEDVYSCFRFLRDVFADEFIF
LPGNTVKDFEEGCYLLCKSEAIQVTTKDILVTEKGNTVLEFLVGLFKPFVESYQIICKYL
LSEEEDHFSEEKYLAAVRKFTSQLLDQGTSQCYDVLSSDVQKNALAACVRLGVVEKKKIN
NNCIFNVNEPATTKLEEMLGCKTPIGKPATAKL
Download sequence
Identical sequences ENSGGOP00000016163 ENSGGOP00000016163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]