SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016180 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016180
Domain Number 1 Region: 157-464
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.05e-111
Family Glutaminase 0.0000101
Further Details:      
 
Domain Number 2 Region: 490-576
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.09e-18
Family Ankyrin repeat 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016180   Gene: ENSGGOG00000016580   Transcript: ENSGGOT00000016639
Sequence length 602
Comment pep:known_by_projection chromosome:gorGor3.1:12:54569290:54587669:-1 gene:ENSGGOG00000016580 transcript:ENSGGOT00000016639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSMKALQKALSRAGSHCGRGGWGHPSRSPLLGGGVRHHLSEAAAQGRETPHSHQPQHQD
HDSSESGMLSRLGDLLFYTIAEGQERIPIHKFTTALKATGLQTSDPRLRDCMSEMHRVVQ
ESSSGGLLDRDLFRKCVSSNIVLLTQAFRKKFVIPDFEEFTGHVDRIFEDVKELTGGKVA
AYIPQLAKSNPDLWGVSLCTVDGQRHSVGHTKVPFCLQSCVKPLTYAISISTLGTDYVHK
FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDFVLQYLNKMAG
NEYMGFSNATFQSEKETGDRNYAIGYYLKEKKCFPKGVDMMAALDLYFQLCSVEVTCESG
SVMAATLANGGICPITGESVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSAVSGA
ILLVVPNVMGMMCLSPPLDKLGNSHRGTSFCQKLVSLFNFHNYDNLRHCARKLDPRREGA
EVRNKTVVNLLFAAYSGDVSALRRFALSAMDMEQKDYDSRTALHVAAAEGHIEVVKFLIE
ACKVNPFVKDRWGNIPLDDAVQFNHLEMVKLLQDYQDSYTLPETQAEAAAEALSKENLES
MV
Download sequence
Identical sequences G3RKB6
ENSGGOP00000016180 XP_004053428.1.27298 ENSGGOP00000016180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]