SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016192 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016192
Domain Number 1 Region: 303-326,523-634,682-752
Classification Level Classification E-value
Superfamily HAD-like 9.75e-36
Family Meta-cation ATPase, catalytic domain P 0.034
Further Details:      
 
Domain Number 2 Region: 2-69,212-308,757-964
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.12e-30
Family Calcium ATPase, transmembrane domain M 0.026
Further Details:      
 
Domain Number 3 Region: 320-352,379-541
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 4.14e-16
Family Metal cation-transporting ATPase, ATP-binding domain N 0.013
Further Details:      
 
Domain Number 4 Region: 68-136,175-198
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.000000000000144
Family Calcium ATPase, transduction domain A 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016192   Gene: ENSGGOG00000016586   Transcript: ENSGGOT00000016651
Sequence length 972
Comment pep:known_by_projection chromosome:gorGor3.1:20:49559640:49687803:-1 gene:ENSGGOG00000016586 transcript:ENSGGOT00000016651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLFNQFKYFFNLYFLLLACSQFVPEMRLGALYTYWVPLGFVLAVTVIREAVEEIRCYVRD
KEVNSQVYSRLTARGTVKVKSSNIQVGDLIIVEKNQRVPADMIFLRTSEKNGSCFLRTDQ
LDGETDWKLRLPVACTQRLPTAADLLQIRSYVYAEEPNIDIHNFVGTFTREDSDPPISES
LSIENTLWAGTVVASGEAPFGMWQFLISSPGLCFVPQIGLFDLEVNCLTKILFGALVVVS
LVMVALQHFAGRWYLQIIRFLLLFSNIIPISLRVNLDMGKIVYSWVIRRDSKIPGTVVRS
STIPEQLGRISYLLTDKTGTLTQNEMIFKRLHLGTVAYGLDSMDEVQSHIFSIYTQQSQD
PPAQKGPTLTTKVRRTMSSRVHEAVKAIALCHNVTPVYESNGVTDQAEAEKQYEDSCRVY
QASSPDEVALVQWTESVGLTLVGRDQSSMQLRTPGDQILNFTILQIFPFTYESKRMGIIV
RDESTGEITFYMKGADVVMAGIVQYNDWLEEECGNMAREGLRVLVVAKKSLAEEQYQDFE
ARYVQAKLSVHDRSLKVATVIESLEMEMELLCLTGVEDQLQADVRPTLETLRNAGIKVWM
LTGDKLETATCTAKNAHLVTRNQDIHVFRLVTNRGEAHLELNAFRRKHDCALVISGDSLE
VCLKYYEYEFMELACQCPAVVCCRCAPTQKAQIVRLLQERTGKLTCAVGDGGNDVSMIQE
SDCGVGVEGKEGKQASLAADFSITQFKHLGRLLMVHGRNSYKRSAALSQFVIHRSLCIST
MQAVFSSVFYFASVPLYQGFLIIGYSTIYTMFPVFSLVLDKDVKSEVAMLYPELYKDLLK
VLLASQSLLRGEYPSLAFAGSTIMYGALLLFESEFVHIVAISFTSLILTELLMVALTIQT
WHWLMTVAELLSLACYIASLVFLHEFIDVYFIATLSFLWKVSVITLVSCLPLYVLKYLRR
RFSPPSYSKLTS
Download sequence
Identical sequences ENSGGOP00000016192 ENSGGOP00000016192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]