SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016208 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016208
Domain Number 1 Region: 3-159
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.06e-67
Family SMAD domain 0.0000000433
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016208   Gene: ENSGGOG00000016612   Transcript: ENSGGOT00000016667
Sequence length 159
Comment pep:known_by_projection chromosome:gorGor3.1:4:155736432:155743755:-1 gene:ENSGGOG00000016612 transcript:ENSGGOT00000016667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKNRFCLGLLSNVNR
NSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNYHHGFHPTTVCKIPSGCS
LKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVK
Download sequence
Identical sequences A1YF07
ENSGGOP00000016208 ENSGGOP00000016208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]