SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016265 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000016265
Domain Number - Region: 29-66,103-120
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0463
Family Voltage-gated potassium channels 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016265   Gene: ENSGGOG00000016673   Transcript: ENSGGOT00000016724
Sequence length 256
Comment pep:known_by_projection chromosome:gorGor3.1:5:16553159:16568245:-1 gene:ENSGGOG00000016673 transcript:ENSGGOT00000016724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPGIYKGHCFRINHFPEDNDYDHDSSEYLLRIVRASSVFPILSTILLLLGGLCIGAGRIY
SRKNNIVLSAGILFVAAGLSNIIGIIVYISSNTGDPSDKRDEDKKNHYNYGWSFYFGALS
FIVAETVGVLAVNIYIEKNKELRFKTKREFLKASSSSPYARMPSYRYRRRRSRSSSRSTE
ASPSRDVSPMGLKITGAIPMGELSMYTLSREPLKVTTAASYSPDQEASFLQVHDFFQQDL
KEGFHVSMLNRRTTPV
Download sequence
Identical sequences ENSGGOP00000016265 ENSGGOP00000016265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]