SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016304 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016304
Domain Number 1 Region: 160-486
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 6.4e-59
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000353
Further Details:      
 
Domain Number 2 Region: 491-625
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.75e-18
Family Ricin B-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016304   Gene: ENSGGOG00000016708   Transcript: ENSGGOT00000016766
Sequence length 637
Comment pep:known_by_projection chromosome:gorGor3.1:12:4844278:4897274:1 gene:ENSGGOG00000016708 transcript:ENSGGOT00000016766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMFWRKLPKALFIGLALAIAVNLLLVFSSKGTLQNLFTGGLHRELPLHLNKRDGAVIKRL
SHLEVELQDLKESMKLALRQQENVNSTLKRAKDEVRPVLKAMETKVNETKKHKTQMKLFP
HSQLFRQWGEDLSEAQQKAAQDLFRKFGYNAYLSNQLPLNRTIPDTRDYRCLRKTYPSQL
PSLSVILIFVNEALSIIQRAITSIINRTPSRLLKEIILVDDFSSNGELKVHLDEKIKFYN
QKYPGLLKIIRHPERKGLAQARNTGWEAATADVVAILDAHIEVNVGWAEPILARIQEDRT
VIVSPVFDNIRFDTFKLDKYELAVDGFNWELWCRYDALPQAWIDLHDVTAPVKSPSIMGI
LAANRHFLGEIGSLDGGMLIYGGENVELSLRVWQCGGKVEILPCSRIAHLERHHKPYALD
LTPALKRNALRVAEIWMDEHKLMVYLAWNIPLQNSGIDFGDISSRMALREKLKCKTFDWY
LKNVYPLLKPLHTIVGYGRMKNLLDENVCLDQGPVPGNTPIMYYCHEFSSQNVYYHLTGE
LYVGQLIAEASASDRCLTDPGNAEKPTLEPCSKAAKNGLHIYWDFKPGGAVINRDTKRCL
EMKKDLSGSHVLVLQTCTTQVWEIQHTVRDWGQTNSQ
Download sequence
Identical sequences ENSGGOP00000016304 ENSGGOP00000016304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]