SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016333 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016333
Domain Number 1 Region: 1120-1305
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 2.86e-49
Family Crystallins/Ca-binding development proteins 0.0000698
Further Details:      
 
Domain Number 2 Region: 1318-1485
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 3.45e-48
Family Crystallins/Ca-binding development proteins 0.0002
Further Details:      
 
Domain Number 3 Region: 923-1107
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 1.09e-47
Family Crystallins/Ca-binding development proteins 0.001
Further Details:      
 
Domain Number 4 Region: 1486-1618
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.51e-19
Family Ricin B-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016333   Gene: ENSGGOG00000016733   Transcript: ENSGGOT00000016797
Sequence length 1625
Comment pep:known_by_projection chromosome:gorGor3.1:6:106575338:106633188:1 gene:ENSGGOG00000016733 transcript:ENSGGOT00000016797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTKRKGXXXXXEAVPAPPASGPRAPAKESPPKRVPDPGPVTKGTAAESGEEAARAIPREL
PVKSSSLLPEIKPEHKRGPLPNHFNGRAEGGRSRELGRAAGAPGASDADGLKPRNHFGVG
RSTVTTKVTLPAKPKHVELNLKTPKNLDSLGNEHNPFSQPVHKGNTATKISLFENKRTNS
SPRHTDIRGPRNTPASSKTFVGRAKLNLAKKAKEMEQPEKKVIPNSPQNGVLVKETAIET
KVTVSEEEILPATRGMNGDRSENQALGPQPNQGDKADVQTDAGCLSEPVASALIPVKDHK
LLEKEDSEAADSKRLVLENVTNTAQDIPTTVDTKDLPPTAMPKPQHTFSDSQSPAESSPG
PSLSLSAPAPGDVPKDTCVQSPISSFPCTDLKVSENHKGCVLPVSRQNNEKMPLSELGGE
TTPPLSTEHSPEAVGSECPSRVLVQVRSFVLPMESTQDVSSQVIPESSEVREVQLPTCHS
NEPEVVSVASCAPPQEEVLGNKSMSPEHSHCTAELAAKSGPQVVPPASEKTLPIRAQSQG
SRTPLMAESSPTNSPSSGNHLATPQRPDQTVTNGQDSPASLLNISAGSDDSVFDSSSDME
KFTEIIKQMDSAVCMPMKRKKARMPNSPAPHFAMPPIHEDHLEKVFDPKVFTFGLGKKKE
SQPEMSPALHLMQNLDTKSKLKPKRASAEQSVLFKSLHTNTNGNSEPLVMPEINDKKNRD
VTNGGIKRSRLEKSALFSSLLSSLPQDKIFSPSVTSVNTMTTAFSTSQNGSLSQSSVSQP
MTEGAPPCGLNKEQSNLLPDNSLKVFNFNSSSTSHSSLKSPSHMEKYPQKEKTKEDLDSR
SNLHLPETKFSELSKLKNDDMEKANHIETVLKSNLPNCANSDTDFMGLFKSSRYDPSISF
SGMSLSDTMTLRGSVQNKLNPRPGKVVIYSEPDVSEKCIEVFGDIQDCSSWSLSPVILIK
VVRGCWILYEQPNFEGHSIPLEEGELELSGLWGIEDILERHEEAESDKPVVIGSIRHVVQ
DYRVSHIDLFTEPEGLGILSSYFDDTEEMQGFGVMQKTCSMKVHWGTWLIYEEPGFQGVP
FILEPGEYPDLSFWDTEAAYIGSMRPLKMGGRKVEFPTDPKVVVYEKPFFEGKCVELETE
MCSFVMEGGETEEATGDDHLPFTSVGSMKVLRGIWVAYEKPGFIGHQYLLEEGEYRDWKA
WGGYNGELQSLRPILGDFSNAHMIMYSEKNFGSKGSSIDVLGIVANLKETGYGVKTQSIN
VLSGVWVAYENPDFTGEQYILDKGFYTSFEDWGGKNCKISSVQPICLDSFTGPRRRNQIH
LFSEPQFQGHSQSFEETTSQIDDSFSTKSCRVSGGSWVVYDGENFTGNQYVLEEGHYPCL
SAMGCPPGATFKSLRFIDVEFSEPTIILFEREDFKGKKIELNAETVNLRSLGFNTQIRSV
QVIGGIWVTYEYGSYRGRQFLLSPAEVPNWYEFSGCRQIGSLRPFVQKRIYFRLRNKATG
LFMSTNGNLEDLKLLRIQVMEDVGADDQIWIYQEGCIKCRIAEDCCLTIVGSLVTSGSKL
GLALDQNADSQFWSLKSDGRIYSKLKPNLVLDIKGGTQYDQNHIILNTVSKEKFTQVWEA
MVLYT
Download sequence
Identical sequences ENSGGOP00000016333 ENSGGOP00000016333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]