SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016355 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016355
Domain Number 1 Region: 508-709
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.15e-21
Family SPRY domain 0.0081
Further Details:      
 
Domain Number 2 Region: 204-267
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 3.66e-16
Family B-box zinc-binding domain 0.00098
Further Details:      
 
Domain Number 3 Region: 431-511
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000502
Family Fibronectin type III 0.0039
Further Details:      
 
Domain Number 4 Region: 25-64
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000783
Family RING finger domain, C3HC4 0.026
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000016355
Domain Number - Region: 149-199
Classification Level Classification E-value
Superfamily RING/U-box 0.0339
Family ZZ domain 0.04
Further Details:      
 
Domain Number - Region: 251-341
Classification Level Classification E-value
Superfamily Prefoldin 0.0392
Family Prefoldin 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016355   Gene: ENSGGOG00000016765   Transcript: ENSGGOT00000016819
Sequence length 728
Comment pep:known_by_projection chromosome:gorGor3.1:5:98222604:98284093:-1 gene:ENSGGOG00000016765 transcript:ENSGGOT00000016819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESGEMSEFGYIMELIAKGKVTIKNIERELICPACKELFTHPLILPCQHSICHKCVKEL
LLTLDDSFNDVGSDNSNQSSPRLRLPSPSMDKIDRINRPGWKRNSLTPRTTVFPCPGCEH
DVDLGERGINGLFRNFTLETIVERYRQAARAATAIMCDLCKPPPQESTKSCMDCSASYCN
ECFKIHHPWGTIKAQHEYVGPTTNFRPKILMCPEHETERINMYCELCRRPVCHLCKLGGN
HANHRVTTMSSAYKTLKEKLSKDIDYLIGKESQVKSQISELNLLMKETECNGERAKEEAI
THFEKLFEVLEERKSSVLKAIDSSKKLRLDKFQTQMEEYQGLLENSGLVGYAQEVLKETD
QSCFVQTAKQLHLRIQKATESLKSFRPAAQTSFEDYVVNTSKQTELLGELSFFSSGIDVP
EINEEQSKVYNSALINWHHPEKDRADSYVLEYRKMNRDDEMSWNEIEVCGTSKIIQDLEN
SSTYAFRVRAYKGSICSPCSRELILHTPPAPVFSFLFDEKCGYNNEHLLLNLKRDRVESR
AGFNLLLAAERIQVGYYTSLDYIIGDTGITKGKHFWAFRVEPYSYLVKVGVASSDKLQEW
LRSPRDAVSPRYEQDSGHDSGSEDACFDSSQPFTLVTIGMKKFFIPKSPTSSNEPENRVL
PMPTSIGIFLDYDKGKVNFYDMDQMKCLYERQVDCSHTLYPAFALMGSGGIQLEEPITAK
YLEYQEDM
Download sequence
Identical sequences G3RKS5
XP_004042417.1.27298 ENSGGOP00000016355 ENSGGOP00000016355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]