SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016366 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016366
Domain Number 1 Region: 14-261
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.64e-68
Family Ankyrin repeat 0.0000629
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000016366
Domain Number - Region: 668-720
Classification Level Classification E-value
Superfamily Prefoldin 0.0706
Family Prefoldin 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016366   Gene: ENSGGOG00000016768   Transcript: ENSGGOT00000016830
Sequence length 727
Comment pep:known_by_projection chromosome:gorGor3.1:6:89525544:89735281:1 gene:ENSGGOG00000016768 transcript:ENSGGOT00000016830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQQDAVAALSERLLIAAYKGQTENVVQLINKGAKVAVTKHGRTPLHLAANKGHLPVVQI
LLKAGCDLDVQDDGDQTALHRATVVGNTEIIAALIHEGCALDRQDKDGNTALHEASWHGF
SQSAKLLVKAGANVLAKNKAGNTALHLACQNSHSQSTRVLLLAGSRADLKNNAGDTCLHV
AARYNHLSIIRLLLTAFCSVHEKNQAGDTALHVAAALNHKKVAKILLEAGADTTIVNNAG
QTPLETARYHNNPEVALLLTKAPQVLRFSRGRSLRKKRERLKEERRAQSVPRDEVAQSKG
SVSAGDTPSSEQAVARKEEAREEFLSASPEPKAKDDRRRKSRPKVSAFSDPTPPADQQPG
HQKNLHAHNHPKKRNRHRCSSPPPPHEFRAYQLYTLYRGKDGKVMQAPINGCRCEPLINK
LENQLEATVEEIKAELGSVQDKMNTKLGQMENKTQHQMRVLDKLMVERLSAERTECLNRL
QQHSDTEKHEGEKRQISLVDELKTWCMLKIQNLEQKLSGDSRACRAKSTPSTCESSTGVD
QLVVTAGPAAASDSSPPVVRPKEKALNSTATQRLQQELSSSDCTGSRLRNVKVQTALLPM
NEAARSDQQAGPCINRGTQTKKSGKSGPTRHRAQQPAASSTCGQPPPATGSEQTGPHIRD
TSQALELTQYFFEAVSTQMEKWYERKIEEARSQANQKAQQDKATLKEHIKSLEEELAKLR
TRVQKEN
Download sequence
Identical sequences G3RKT5
XP_004044453.1.27298 ENSGGOP00000016366 ENSGGOP00000016366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]