SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016408 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016408
Domain Number 1 Region: 312-485,514-575
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.75e-45
Family Voltage-gated potassium channels 0.0019
Further Details:      
 
Domain Number 2 Region: 579-764
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.42e-44
Family cAMP-binding domain 0.00047
Further Details:      
 
Domain Number 3 Region: 12-101
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.24e-21
Family Flavin-binding PAS domain 0.00000483
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016408   Gene: ENSGGOG00000016814   Transcript: ENSGGOT00000016873
Sequence length 913
Comment pep:known_by_projection chromosome:gorGor3.1:7:149407688:149439577:-1 gene:ENSGGOG00000016814 transcript:ENSGGOT00000016873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPRTQRRAAAQIAQAL
LGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEKDMVGSPAHDTN
HRGPPTSWLAPGRAKTFRLKLPALLALTARGSSVRSGLPSPRAHSLNPDASGSSCSLART
RSRESCASVRRASSADDIEAMRAGVLPPPPRHASTGAMHPLRSGLLNSTSDSDLVRYRTI
SKIPQITLNFVDLKGDPFLASPTSDREIIAPKIKERTHNVTEKVTQVLSLGANVLPEYKL
QAPRIHRWTILHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLKETEEGPPATECGYACQ
PLAVVDLIVDIMFIVDILINFRTTYVNANEEVVSHPGRIAVHYFKGWFLIDMVAAIPFDL
LIFGSGSEELIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWYA
IGNMEQPHMDSRIGWLHNLGDQIGKPYNSSGLGGPSIKDKYVTALYFTFSSLTSVGFGNV
SPNTNSEKIFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVREFIRFHQIP
NPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHLNRSLLQHCKPFRGATKGC
LRALAMKFKTTHAPPGDTLVHAGDLLTALYFISRGSIEILRGDVVVAILGKNDIFGEPLN
LYARPGKSNGDVRALTYCDLHKIHRDDLLEVLDMYPEFSDHFWSSLEITFNLRDTNVIPG
SPGSTELEGGFSHLRKLSFRRRTDKLETRLSADMATVLQLLQRQMTLVPPAYSAVTTPGP
GPTSTSPLLPVSPLPTLTLDSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALT
SQPLHRHGSDPGS
Download sequence
Identical sequences ENSGGOP00000016408 ENSGGOP00000016408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]