SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016415 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016415
Domain Number 1 Region: 44-145
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.69e-17
Family Splicing factor U2AF subunits 0.0000142
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000016415
Domain Number - Region: 16-41
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00034
Family CCCH zinc finger 0.0055
Further Details:      
 
Domain Number - Region: 151-173
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000597
Family CCCH zinc finger 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016415   Gene: ENSGGOG00000016828   Transcript: ENSGGOT00000016880
Sequence length 220
Comment pep:novel chromosome:gorGor3.1:19:33041714:33044603:-1 gene:ENSGGOG00000016828 transcript:ENSGGOT00000016880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKSTFSQTIVLLSLYRNPQNAAQ
TADGSHCHVSDVEVQEHYDSFFEEVFTELQEKYGEIEEMNVCDNLGDHLVGNVYVKFRRE
EDGQWAVAELNNRWFNGQAVHVELSPVTDFRESCCRQYEMGECTRGGFCNFMHLQPISQN
LQRQLYGRGPRRRSPPRFHTGHHPRERNHRCSPDHRHGRF
Download sequence
Identical sequences G3RKY3
ENSGGOP00000016415 ENSGGOP00000016415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]