SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016417 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016417
Domain Number 1 Region: 61-209
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 2.48e-29
Family Glycerol-3-phosphate (1)-acyltransferase 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016417   Gene: ENSGGOG00000016829   Transcript: ENSGGOT00000016882
Sequence length 232
Comment pep:known_by_projection chromosome:gorGor3.1:9:120312289:120326091:-1 gene:ENSGGOG00000016829 transcript:ENSGGOT00000016882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELWPCLAAALLLLLLLVQLSRAAEFYAKVALYCALCFTVSAVASLVCLLRHGGRTVENM
LMEVLPERCVQIAKRELLFLGPVGLIMYLGGVFFINRQRSSTAMTVMADLGERMVRENLK
VWIYPEGTRNDNGDLLPFKKGAFYLAVQAQVPIVPVVYSSFSSFYNTKKKFFTSGTVTVQ
VLEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSGVQPAQ
Download sequence
Identical sequences ENSGGOP00000016417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]