SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016440 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016440
Domain Number 1 Region: 1162-1317,1353-1432
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.16e-40
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 2 Region: 1482-1673,1707-1732
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.42e-38
Family Voltage-gated potassium channels 0.021
Further Details:      
 
Domain Number 3 Region: 133-278,368-437
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.28e-31
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 4 Region: 717-864,898-930
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.02e-27
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000016440
Domain Number - Region: 1741-1785
Classification Level Classification E-value
Superfamily EF-hand 0.00745
Family Calmodulin-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016440   Gene: ENSGGOG00000016833   Transcript: ENSGGOT00000016905
Sequence length 1957
Comment pep:known_by_projection chromosome:gorGor3.1:2b:52819702:52938681:-1 gene:ENSGGOG00000016833 transcript:ENSGGOT00000016905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQALLVPPGPESFRLFTRESLAAIEKRAAEEKAKKPKKEQDNDDENKPKPNSDLEAGKN
LPFIYGDIPPEMVSEPLEDLDPYYINKKTFIVMNKGKAIFRFSATSALYILTPLNPVRKI
AIKILVHSYPFNSTLFSMLIMCTILTNCVFMTLSNPPDWTKNVEYTFTGIYTFESLIKIL
ARGFCLEDFTFLRDPWNWLDFSVIVMAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLK
TIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPSDSAFETNTTSY
FNGTMDSNGTFVNVTMSTFNWKDYIGDDSHFYVLDGQKDPLLCGNGSDAGQCPEGYICVK
AGRNPNYGYTSFDTFSWAFLSLFRLMTQDYWENLYQLTLRAAGKTYMIFFVLVIFLGSFY
LVNLILAVVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKKQQEEAQAVAAASAASRDFSG
IGGLGELLESSSEASKLSSKSAKEWRNRRKKRRQREHLEGNNKGERDSFPKSESEDSVKR
SSFLFSMDGNRLTSDKKFCSPHQSLLSIRGSLFSPRRNSKTSIFSFRGRAKDVGSENDFA
DDEHSTFEDSESRRDSLFVPHRHGERRNSNGTTTETEVRKRRLSSYQISMEMLEDSSGRQ
RAMSIASILTNTMEELEESRQKCPPCWYRFANVFLIWDCCDAWLKVKHLVNLIVMDPFVD
LAITICIVLNTLFMAMEHYPMTEQFSSVLTVGNLVFTGIFTAEMVLKIIAMDPYYYFQEG
WNIFDGIIVSLSLMELGLSNVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALG
NLTLVLAIIVFIFAVVGMQLFGKSYKECVCKINDDCTLPRWHMNDFFHSFLIVFRVLCGE
WIETMWDCMEVAGQTMCLIVFMLVMVIGNLVVRINIRFSFLLQTMHCNYPSNLEEDKMFS
SLNLHYYRKTNYYSLNYSYSCVGKAFLYAIILGLSFEGYISDKLLQKNATGIPTNMKLTF
LKTSYSATSGQNYVYSIDMYYINPNKLITFTNICNLMTFPITKKYTQSSGNMGSEGFQME
KIFGQRKQKLNATSSSEGSTVDVVLPREGEQAETEPEEDLKPEACFTEGCIKKFPFCQVS
TEEGKGKIWWNLRKTCYSIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYA
DKVFTYIFILEMLLKWVAYGFQTYFTNAWCWLDFLIVDVSLVSLVANALGYSELGAIKSL
RTLRALRPLRALSRFEGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYH
CVNMTTGNMFDVSDVNNLSDCQALGKQARWKNVKVNFDNVGAGYLALLQVATFKGWMDIM
YAAVDSRDVKLQPVYEENLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDI
FMTEEQKKYYNAMKKLGSKKPQKPIPRPANKFQGMVFDFVTRQVFDISIMILICLNMVTM
MVETDDQGKYMTLVLSRINLVFIVLFTGEFVLKLVSLRHYYFTIGWNIFDFVVVILSIVG
MFLAEMIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLF
LVMFIYAIFGMSNFAYVKKEAGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSAP
PDCDPDTIHPGSSVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAE
PLSEDDFEMFYEVWEKFDPDATQFIEFSKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVS
GDRIHCLDILFAFTKRVLGESGEMDALRIQMEDRFMASNPSKVSYEPITTTLKRKQEEVS
AAIIQRNFRCYLLKQRLKNISSNYNKEAIKGRIDLPIKQDMIIDKLNGNSTPEKTDGSSS
TTSPPSYDSVTKPDKEKFEKDKPEKESKGKEVRENQK
Download sequence
Identical sequences ENSGGOP00000016440 ENSGGOP00000016440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]