SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016442 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016442
Domain Number 1 Region: 417-601
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.5e-45
Family cAMP-binding domain 0.00033
Further Details:      
 
Domain Number 2 Region: 232-322,352-413
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.66e-33
Family Voltage-gated potassium channels 0.0025
Further Details:      
 
Domain Number 3 Region: 38-131
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.19e-19
Family Flavin-binding PAS domain 0.0000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016442   Gene: ENSGGOG00000016845   Transcript: ENSGGOT00000016907
Sequence length 890
Comment pep:known_by_projection chromosome:gorGor3.1:5:20204074:20229029:-1 gene:ENSGGOG00000016845 transcript:ENSGGOT00000016907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVRRGHVAPQNTYLDTIIRKFEGQSRKFLIANAQMENCAIIYCNDGFCELFGYSRVEVM
QQPCTCDFLTGPNTPSSAVSRLAQALLGAEECKVDILYYRKDASSFRCLVDVVPVKNEDG
AVIMFILNFEDLAQLLAKHSSRSLSQRLLSQSFLGSEGSHGRPGGPGPGTGRGKYRTISQ
IPQFTLNFVEFNLEKHRSSSTTEIEIIAPHKVVERTQNVTEKVTQVVSHPRRIAVHYFKG
WFLIDMVAAIPFDLLIFRTGSDETTTLIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLL
MCTFALIAHWLACIWYAIGNVERPYLEHKIGWLDSLGVQLGKRYNGSDPASGPSVQDKYV
TALYFTFSSLTSVGFGNVSPNTNSEKVFSICVMLIGSLMYASIFGNVSAIIQRLYSGTAR
YHTQMLRVKEFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHL
HRALLQHCPAFSGASKGCLRALAVKFKTTHAPPGDTLVHLGDVLSTLYFISRGSIEILRD
DVVVAILGKNDIFGEPISLHAQPGKSSADVRALTYCDLHKIQRADLLEVLDMYPAFADSF
WSKLEVTFNLRDAAGGLHSSPRQAPGSQDHQGFFLSDNQSGSPHELGPQFPSKGYSLLGP
GSQNSMGAGPCAPGHPDAAPPLSISDASGLWPELLQEMPPRHSPQSPQKDPDCWPLKLGS
RLEQLQAQMNRLESRMSSDLSRILQLLQQPMPQGHASYILEAPASNDLALVPVASETRSP
GPRLPQGFLPPAQTPSYGDLDDCSPKYRNSSPRMPHLAVATDKTLAPSSEQEQPEGLWPP
LASPLHPLEVQGLICGPCFSSLPEHLGSVPKQLDFQRHGSDPGFAGSWGH
Download sequence
Identical sequences ENSGGOP00000016442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]