SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016490 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016490
Domain Number 1 Region: 288-462
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.71e-47
Family SPRY domain 0.0000324
Further Details:      
 
Domain Number 2 Region: 9-89
Classification Level Classification E-value
Superfamily RING/U-box 4.95e-21
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Domain Number 3 Region: 93-154
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.05e-16
Family B-box zinc-binding domain 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016490   Gene: ENSGGOG00000016899   Transcript: ENSGGOT00000016955
Sequence length 477
Comment pep:known_by_projection chromosome:gorGor3.1:1:208623482:208632463:-1 gene:ENSGGOG00000016899 transcript:ENSGGOT00000016955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAVELARKLQEEATCSICLDYFTDPVMTACGHNFCRACIQLSWEKARGKKGRRKRKGSF
PCPECREMSPQRNLLPNRLLTKVAEMARQHPGLQKQDLCQEHHEPLKLFCQKDQSPICVV
CRESREHRLHRVLPAEEAVQGYKLKLEEDMEYLREQITRTGNLQAREEQSLAEWQGKVKE
RRERIVLEFEKMNLYLVEEEQRLLQALETEEDETASRLRESMACLDRQGHSLELLLLQLE
ERSTQAPLQMLQDMKEPLSRKSNVSVQCPEVAPPTRPRTVCRVPGQIEVLRGFLEDVVPD
ATSAYPYLLLYESRQRRYLGCSPEGSGFCSKDRFVAYPCAVGQTAFSSGRHYWEVGLNIT
GDALWALGVCRDNVSRKDRVPKCPENGFWVVQLSKGTKYLSAFSALTPVMLMEPPSHMGI
FLDFEAGEVSFYSVSDGSHLHTYSQATFPGPLQPFFCLGAPKSGQMVISTVTMWVKG
Download sequence
Identical sequences XP_018887113.1.27298 XP_018887122.1.27298 ENSGGOP00000016490 ENSGGOP00000016490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]