SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016527 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016527
Domain Number 1 Region: 43-456
Classification Level Classification E-value
Superfamily SIS domain 1.56e-158
Family Phosphoglucose isomerase, PGI 0.000000000000429
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016527   Gene: ENSGGOG00000016932   Transcript: ENSGGOT00000016992
Sequence length 460
Comment pep:known_by_projection chromosome:gorGor3.1:19:31616760:31650148:1 gene:ENSGGOG00000016932 transcript:ENSGGOT00000016992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVALCSLQLLGSSDPRALPTLPTATSGQRPAKRRRKSPAMAALTRDPQFQKLQQWYREHG
SELNLRRLFDANKDRFNHFSLTLNTNHGHILVDYSKNLVTEDVMRMLVDLAKSRGVEAAR
ERMFNGEKINYTEGPLMVTEALKPYSSGGPRVWYVSNIDGTHIAKTLAQLNPESSLFIIA
SKTFTTQETITNAETAKEWFLQAAKDPSAVAKHFVALSTNTTKVKEFGIDPQNMFEFWDW
VGGRYSLWSAIGLSIALHVGFDNFEQLLSGAHWMDQHFRTTPLEKNAPVLLALLGIWYIN
CFGCETHAMLPYDQYLHRFAAYFQQILLANFLAQTEALMRGKSTEEARKELQAAGKSPED
LERLLPHKVFEGNRPTNSIVFTKLTPFMLGALVAMYEHKIFVQGIIWDINSFDQWGVELG
KQLAKKIEPELDGSAQVTSHDASTNGLINFIKQQREARVQ
Download sequence
Identical sequences ENSGGOP00000016527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]