SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016545 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016545
Domain Number 1 Region: 224-506
Classification Level Classification E-value
Superfamily Kelch motif 4.45e-46
Family Kelch motif 0.0034
Further Details:      
 
Domain Number 2 Region: 646-792
Classification Level Classification E-value
Superfamily C-type lectin-like 1.17e-23
Family C-type lectin domain 0.0031
Further Details:      
 
Domain Number 3 Region: 2-110
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-20
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000016545
Domain Number - Region: 110-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0067
Family EGF-type module 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016545   Gene: ENSGGOG00000016945   Transcript: ENSGGOT00000017010
Sequence length 1246
Comment pep:known_by_projection chromosome:gorGor3.1:20:3600087:3712414:1 gene:ENSGGOG00000016945 transcript:ENSGGOT00000017010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTGSSGFVTDGPGNYKYKTKCTWLIEGQPNRIMRLRFNHFATECSWDHLYVYDGDSIYAP
LVAAFSGLIVPERDGNETVPEVVATSGYALLHFFSDAAYNLTGFNITYSFDMCPNNCSGR
GECKISNSSDTVECECSENWKGEACDIPHCTDNCGFPHRGICNSSDVRGCSCFSDWQGPG
CSVPVPANQSFWTREEYSNLKLPRASHKAVVNGNIMWVVGGYMFNHSDYNMVLAYDLASR
EWLPLNRSVNNVVVRYGHSLALYKDKIYMYGGKIDSTGNVTNELRVFHIHNESWMLLTPK
AKEQYAVVGHSAHIVTLKNGRVVMLVIFGHCPLYGYISNVQEYDLDKNTWSILHTQGALV
QGGYGHSSVYDHRTRALYVHGGYKAFSANKYRLADDLYRYDVDTQMWTILKDSRFFRYLH
TAVIVSGTMLVFGGNTHNDTSMSHGAKCFSSDFMAYDIACDRWSVLPRPDLHHDVNRFGH
SAVLHNSTMYVFGGFNSLLLSDILVFTSEQCDARRSETACLAAGPGIRCVWNTGSSQCIS
WALATDEQEEKLKSECFSKTTLDHDRCDQHTDCYSCTANTNDCHWCNDHCVPRNHSCSEG
QISIFRYENCPKDNPMYYCNKKTSCRSCALDQNCQWEPRNQECIALPENICGIGWHLVGN
SCLKITTAKENYDNAKLFCRNHNALLASLTTQKKVEFVLKQLRIMQSSQSMSKLTLTPWV
GLRKINVSYWCWEDMSPFTNSLLQWMPSEPSDAGFCGILSEPSTRGLKAATCINPLNGSV
CERPANHSAKQCRTPCALRTACGDCTSGSSECMWCSNMKQCVDSNAYVASFPFGQCMEWY
TMSTCPPENCSGYCTCSHCLEQPGCGWCTDPSNTGKGKCIEGSYKGPVKMPSQAPTGNFY
PQPLLNSSMCLEDSRYNWSFIHCPACKCNGHASLCNTNTGKCFCTTKGVKGDECQLCEVE
NRYQGNPLKGTCYYTLLIDYQFTFSLSQEDDRYYTAINFVATPDEQNRDLDMFINASKNF
NLNITWAASFSAGTQAGEEMPVVSKTNIKEYKDSFSNEKFDFRNHPNITFFVYVSNFTWP
IKIQIAFSQHSNFMDLVQFFVTFFSCFLSLLLVAAVVWKIKQSCWASRRREQLLREMQQM
ASRPFASVNVALETDEEPPDLIGGSIKTVPKPIALEPCFGNKAAVLSVFVRLPRGLGGIP
PPGQSGLAVASALVDISQQMPIVYKEKSGAVRNRKQQPPAQPGTCI
Download sequence
Identical sequences ENSGGOP00000016545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]