SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016549 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016549
Domain Number 1 Region: 224-282
Classification Level Classification E-value
Superfamily RING/U-box 1.08e-20
Family RING finger domain, C3HC4 0.0039
Further Details:      
 
Domain Number 2 Region: 51-154
Classification Level Classification E-value
Superfamily PA domain 0.00000000129
Family PA domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016549   Gene: ENSGGOG00000016958   Transcript: ENSGGOT00000017015
Sequence length 362
Comment pep:known_by_projection chromosome:gorGor3.1:2a:98725604:98757929:-1 gene:ENSGGOG00000016958 transcript:ENSGGOT00000017015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XXVVNIEYVDPQTNLTVWSVSESGRFGDSSPKEGAHGLVGVPWAPGGDLEGCAPDTRFFV
PEPGGRGAAPWVALVARGGCTFKDKVLVAARRNASAVVLYNEERYGNITLPMSHAGTGNI
VVIMISYPKGREILELVQKGIPVTMTIGVGTRHVQEFISGQSVVFVAIAFITMMIISLAW
LIFYYIQRFLYTGSQIGSQSHRKETKKVIGQLLLHTVKHGEKGIDVDAENCAVCIENFKV
KDIIRILPCKHIFHRICIDPWLLDHRTCPMCKLDVIKALGYWGEPGDVQEMPAPESPPGR
DPAANLSLTLPDDDGSDESSPPSASPAASEPQCDPSFKGDAGENTALLEASRSDSRHGGP
IS
Download sequence
Identical sequences ENSGGOP00000016549 ENSGGOP00000016549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]