SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016556 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016556
Domain Number 1 Region: 548-633
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.09e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016556   Gene: ENSGGOG00000016962   Transcript: ENSGGOT00000017022
Sequence length 752
Comment pep:known_by_projection chromosome:gorGor3.1:7:70595616:70626358:-1 gene:ENSGGOG00000016962 transcript:ENSGGOT00000017022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGALAGLAAGLQVPRVAPSPDSDSDTDSEDPSLRRSAGGLLRSQVIHSGHFMVSSPHSD
SLPRRRDQEGSMGPSDFGPRSIDPTLTRLFECLSLAYSGKLVSPKWKNFKGLKLLCRDKI
RLNNAIWRAWYIQYVERRKSPVCGFVTPLQGPEADAHRKPEAVVLEGNYWKRRIEVVMRE
YHKWRIYYKKRLRKPSREEDLLAPKQAEGRWPPPEQWCKELFSSVVPVLLGDPEEEPGGR
QLLDLNCFLSDISDTLFTMTQSGPSPLQLPPEDAYVGNADMIQPDLTPLQPSLDDFMDIS
DFFTNSRPPQPPMPSNFPEPPSFSPMVDSLFSSGTLGPEVPPASSAMTHLSGHSRLQVSS
PHPVQPCVAHLRAGPALFMSRNQFPICNSFFFFKPPAPSPRGQKASPPTLAPATASPPTT
AGSNNPCLTQLLTAAKPEQALEPPLVSSTLLRSPGSPQETVPEFPCTFLPPTPAPTPPRP
PPGPATLAPSRPLLVPKAERLSPPAPSGSERQLSGDLSSMPGPGTLSVRVSPPQPILSRG
RPDSNKTENRRITHISAEQKRRFNIKLGFDTLHGLVSTLSAQPSLKVSKATTLQKTAEYI
IMLQQERAGLQEEAQQLRDEIEELNAAINLCQQQLPATGVPITHQRFDQMRDMFDDYVRT
RTLHNWKFWVFSILIRPLFESFNGMVSTASVHTLRQTSLAWLDQYCSLPALRPTVLNSLR
QLGTSTSILTDPGRIPEQATRAVTEGTLGKPL
Download sequence
Identical sequences ENSGGOP00000016556 ENSGGOP00000016556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]