SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016563 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016563
Domain Number 1 Region: 187-413
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 1.44e-17
Family Glycerol-3-phosphate (1)-acyltransferase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016563   Gene: ENSGGOG00000016969   Transcript: ENSGGOT00000017029
Sequence length 829
Comment pep:known_by_projection chromosome:gorGor3.1:10:126025414:126059681:-1 gene:ENSGGOG00000016969 transcript:ENSGGOT00000017029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEESALTLGTIDVSYLPNSSEYSVGRCKHTSEEWGECGFRPTVFRSATLKWKESLMSRKR
PFVGRCCYSCTPQSWDKFFNPSIPSLGLRNVIYINETHTRHRGWLARRLSYVLFIQERDV
HKGMFATNVTENVLNSSRVQEAIAEVAAELNPDSSAQQQSKAVNKVKKKAKRILQEMVAT
VSPAMIRLTGWVLLKLFNSFFWNIQIHKGQLEMVKAATETNLPLLFLPVHRSHIDYLLLT
FILFCHNIKAPYIASGNNLNIPIFSTLIHKLGGFFIRRRLDETPDGRKDVLYRALLHGHI
VELLRQQQFLEIFLEGTRSRSGKTSCARAGLLSVVVDTLSTNVIPDILIIPVGISYDRII
EGHYNGEQLGKPKKNESLWSVARGVIRMLRKNYGCVRVDFAQPFSLKEYLESQSQKPVSA
PLSLEQALLPAILPSRPSDAADEDRDMSINESRNATDESLRRRLIANLAEHILFTASKSC
AIMSTHIVACLLLYRHRQGIDLSTLVEDFFVMKEEVLARDFDLGFSGNSEDVVMHAIQLL
GNCVTITHTSRNDEFFITPSTTVPSVFELNFYSNGVLHVFIMEAIIACSLYAVLNKRGLG
GPTSTPPNLISQEQLVRKAASLCYLLSNEGTISLPCQTFYQVCHETVGKFIQYGILTVAE
HDDQEDISPSLAEQQWDKKLPEPLSWRSDEEDDEDSDFGEEQRDCYLKVSQSKEHQQFIT
FLQRLLGPLLEAYSSAAIFVHNFSGPVPEPEYLQKLHKYLITRTERNVAVYAESATYCLV
KNAVKMFKDIGVFKETKQKRVSVLELSSTFLPQCNRQKLLEYILSFVVL
Download sequence
Identical sequences G3RLC0
ENSGGOP00000016563 XP_004050152.1.27298 XP_018890957.1.27298 ENSGGOP00000016563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]