SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016566 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016566
Domain Number 1 Region: 182-314
Classification Level Classification E-value
Superfamily PH domain-like 1.2e-39
Family Pleckstrin-homology domain (PH domain) 0.000000792
Further Details:      
 
Domain Number 2 Region: 411-517
Classification Level Classification E-value
Superfamily SH2 domain 4.44e-24
Family SH2 domain 0.00000443
Further Details:      
 
Domain Number 3 Region: 21-81
Classification Level Classification E-value
Superfamily Phenylalanine zipper 2.22e-22
Family Adapter protein APS, dimerisation domain 0.0000195
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016566   Gene: ENSGGOG00000016975   Transcript: ENSGGOT00000017032
Sequence length 629
Comment pep:known_by_projection chromosome:gorGor3.1:7:99851652:99873345:1 gene:ENSGGOG00000016975 transcript:ENSGGOT00000017032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGACPGPAVAAPVPIPVPVPDWRQFCELHAQAAAVDFAHKFCRFLQDNPAYDTPDAGAS
FSRHFAANFLDVFGEEVRRVLVAGPTTRGAAVSAEAMEPELADTSALKAAPYGHSRSSED
VSTHAATKARVRKGFSLRNMSLCVVDGVRDMWHRRASPEPDAAAAPRTAEPSAEPRDKWT
RRLRLSRTLAAKVELVDIQREGALRFMVADDAAAGSGGSAQWQKCRLLLRRAVAEERFRL
EFFVPPKASRPKVSIPLSAIIEVRTTMPLEMPEKDNTFVLKVENGAEYILETIDSLQKHS
WVADIQGCVDTGPGPGDLEGSWTRSCLHPKRASEHWELGRDGSESPKGNNNFKRCASVQA
PGTRRRDARPGVGGIGSPTGSPHVPHTVIPTSGEQGAETDPEAEPELELSDYPWFHGTLS
RVKAAQLVLAGGPRNHGLFVIRQSETRPGEYVLTFNFQGKAKHLRLSLNGHGQCHVQHLW
FQSVLDMLRHFHTHPIPLESGGSADITLRSYVRAQGPPPEPGPTPPASPASPACWSDSPG
QHYSSLAAAAACPPASPSDAAGASLSSASSSSAASGPAPPRPVEGQLSARSRSNSAERLL
EAVAATAAEEPPEAAPGRARAVENQYSFY
Download sequence
Identical sequences ENSGGOP00000016566 ENSGGOP00000016566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]