SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016587 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016587
Domain Number 1 Region: 235-560
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.3e-79
Family Epoxide hydrolase 0.00000000021
Further Details:      
 
Domain Number 2 Region: 1-217
Classification Level Classification E-value
Superfamily HAD-like 4.29e-37
Family YihX-like 0.00000000423
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016587   Gene: ENSGGOG00000016993   Transcript: ENSGGOT00000017053
Sequence length 572
Comment pep:known_by_projection chromosome:gorGor3.1:8:27456428:27510145:1 gene:ENSGGOG00000016993 transcript:ENSGGOT00000017053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLRAAVFDLDGVLSLPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGATTRLMRGEITL
SQWIPLMEENCRKCSETAKVCLPKNFSIKEIFDKAISARKINRPMLQAALMLRKKGFTTA
ILTNTWLDDRAERDGLAQLMCELKTHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEV
IFLDDIGANLKPARDLGMVTILVQNTDTALKELEKVTGIQILNTPAPLLTSCNPSDMSHG
YVTVKPGVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESS
APPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNT
PFIPANPNVSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMH
KVCEAGKRHAWESHIWNQLNVKGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPL
NWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSKHMEDWIPHLKRGHIEDCG
HWTQMDKPTEVNQILIKWLDSDARNPPVVSKM
Download sequence
Identical sequences ENSGGOP00000016587 ENSGGOP00000016587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]