SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016597 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016597
Domain Number 1 Region: 1-226
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 3.14e-91
Family Fibrinogen C-terminal domain-like 0.000000581
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016597   Gene: ENSGGOG00000017006   Transcript: ENSGGOT00000017063
Sequence length 231
Comment pep:known_by_projection chromosome:gorGor3.1:8:17583807:17593663:-1 gene:ENSGGOG00000017006 transcript:ENSGGOT00000017063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DCSEIFNDGYKLSGFYKIKPLRSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYE
NGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYE
LNVGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRC
HSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI
Download sequence
Identical sequences ENSGGOP00000016597 ENSGGOP00000016597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]