SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016707 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016707
Domain Number 1 Region: 37-111,233-333,416-459
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.000000141
Family YVTN repeat 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016707   Gene: ENSGGOG00000017120   Transcript: ENSGGOT00000017178
Sequence length 478
Comment pep:known_by_projection chromosome:gorGor3.1:1:104536541:104585532:-1 gene:ENSGGOG00000017120 transcript:ENSGGOT00000017178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPPLLKLGAVLSTMAMISNWMSQTLPSLVGLNTTRLSTPDILTQISPKEGWQVYSSAQD
PDGRCICTVVAPEQNLCSRDAKSRQLRQLLEKVQNMSQSIEVLNLRTQRDFQYVLKMETQ
MKGLKAKFRQIEDDRKTLMTKHFQELKEKMDELLPLIPVLEQYKTDAKLITQFKEEIRNL
SAVLTGIQEEIGAYDYEELHQRVLSLETRLRDCMKKLTCGKLMKITGPVTVKTSGTRFGA
WMTDPLASEKNNRVWYMDSYTNNKIVREYKSIADFVSGAESRTYNLPFKWAGTNHVVYNG
SLYFNKYQSNIIIKYSFDMGRVLAQRSLEYAGFHNVYPYTWGGFSDIDLMADEIGLWAVY
ATNQNAGNIVISQLNQDTLEVMKSWSTGYPKRSAGESFMICGTLYVTNSHLTGAKVYYSY
STKTSTYEYTDIPFHNQYFHISMLDYNARDRALYAWNNGHQVLFNVTLFHIIKTEDDT
Download sequence
Identical sequences G3RLQ0 H2PZI2
ENSGGOP00000016707 ENSPTRP00000001747 9598.ENSPTRP00000001747 XP_009424813.1.37143 XP_018892895.1.27298 ENSGGOP00000016707 ENSPTRP00000001747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]