SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016724 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016724
Domain Number 1 Region: 126-281
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000135
Family Polcalcin 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016724   Gene: ENSGGOG00000017137   Transcript: ENSGGOT00000017195
Sequence length 563
Comment pep:known_by_projection chromosome:gorGor3.1:3:50240861:50258043:1 gene:ENSGGOG00000017137 transcript:ENSGGOT00000017195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAVTGQRPETAAAEEASRPQWAPPDHCQAQAAAGLGDGEDAPVRPLCKPRGICSRAY
FLVLMVFVHLYLGNVLALLLFVHYSNGDESSDPGPQHRAQGPGPEPTLGPLTRLEGIKVG
HERKVQLVTDRDHFIRTLSLKPLLFEIPGFLTDEECRLIIHLAQMKGLQRSQILPTEEYE
EAMSTMQVSQLDLFRLLDQNRDGHLQLREVLAQTRLGNGWWMTPESIQEMYAAIKADPDG
DGVLSLQEFSNMDLRDFHKYMRNHKAESSELVRNSHHTWLYQGEGAHHVMRAIRQRVLRL
TRLSPEIVELSEPLQVVRYGEGGHYHAHVDSGPVYPETICSHTKLVANESVPFETSCRQV
SPNWGLPSILRPGTPMTQAQPCTVGVPLGMGPGDHWVIPVSPWEHPQLGTCSVAPLPYSY
MTVLFYLNNVTGGGETVFPVADNRTYDEMSLIQDDVDLRDTRRHCDKGNLRVKPRQGTAV
FWYNYLPDGQGWVGDVDDYSLHGGCLVTRGTKWIANNWINVDPSRARQALFQQEMARLAR
EGGTDSQPEWALDRAYRDARVEL
Download sequence
Identical sequences G3RLR4
XP_004034160.1.27298 ENSGGOP00000016724 ENSGGOP00000016724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]