SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016754 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016754
Domain Number 1 Region: 3-82
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000031
Family Calmodulin-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016754   Gene: ENSGGOG00000017168   Transcript: ENSGGOT00000017225
Sequence length 119
Comment pep:known_by_projection chromosome:gorGor3.1:9:114676217:114684939:1 gene:ENSGGOG00000017168 transcript:ENSGGOT00000017225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EFLCDQKYSDEENLPEKLTAFKEKYMEFDLNNEGEIDLMSLKRMMEKLGVPKTHLEMKKM
ISEVTGGVSDTISYRDFVNMMLGKRSAVLKLVMMFEGKANESSPKPVGPPPERDIASLP
Download sequence
Identical sequences ENSGGOP00000016754 ENSGGOP00000016754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]