SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016763 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016763
Domain Number 1 Region: 202-303
Classification Level Classification E-value
Superfamily HSP20-like chaperones 1.08e-22
Family GS domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016763   Gene: ENSGGOG00000017176   Transcript: ENSGGOT00000017234
Sequence length 311
Comment pep:novel chromosome:gorGor3.1:1:72690980:72691957:1 gene:ENSGGOG00000017176 transcript:ENSGGOT00000017234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLCYNWGCGQRFDPETDSDDACTYHPGVPVFYDALKGWSCCKRKTTDFSDFLSIVGCT
KGRHNSEKPPEPVKPEVKTTEKKELSELKPKFQEHIIQAPKPVEAIKMPSPDEPMTNLEL
KISASLKQALDKLSSGNEEDEIKTGTSCKNRGCSKTYWGLESLEEVCVYHSGVPVFHEGM
KYLSCCRRKTSDFNTFLAQEGCTTGKHMWTKKDAGEKVVPCRHNWHQTGGEVTISTYAKD
SQNLANSTLLNVHIVFEGEKEFDQNVKIWGVIDVNTTATKIEITMRKAEPMQWASLELPA
AKKQEKQKDDP
Download sequence
Identical sequences ENSGGOP00000016763 ENSGGOP00000016763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]