SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016764 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016764
Domain Number 1 Region: 1444-1552
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.77e-35
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 2 Region: 746-860
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.71e-33
Family Spermadhesin, CUB domain 0.00078
Further Details:      
 
Domain Number 3 Region: 1967-2076
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.02e-32
Family Spermadhesin, CUB domain 0.00053
Further Details:      
 
Domain Number 4 Region: 1790-1909
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.37e-32
Family Spermadhesin, CUB domain 0.00063
Further Details:      
 
Domain Number 5 Region: 582-686
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-31
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 6 Region: 202-304
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.97e-30
Family Spermadhesin, CUB domain 0.00075
Further Details:      
 
Domain Number 7 Region: 30-133
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-28
Family Spermadhesin, CUB domain 0.00042
Further Details:      
 
Domain Number 8 Region: 405-515
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-28
Family Spermadhesin, CUB domain 0.00076
Further Details:      
 
Domain Number 9 Region: 1264-1385
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-27
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 10 Region: 2139-2246
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-26
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 11 Region: 1097-1206
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-26
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 12 Region: 2319-2423
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-26
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 13 Region: 918-1039
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.72e-26
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 14 Region: 1612-1727
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-23
Family Spermadhesin, CUB domain 0.0058
Further Details:      
 
Domain Number 15 Region: 2614-2683
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.09e-18
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 16 Region: 3032-3100
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.15e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 17 Region: 2855-2922
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.22e-17
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 18 Region: 2672-2739
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.63e-17
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 19 Region: 2971-3037
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.05e-16
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 20 Region: 3151-3219
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.8e-16
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 21 Region: 2912-2982
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.64e-16
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 22 Region: 342-414
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000107
Family Complement control module/SCR domain 0.00093
Further Details:      
 
Domain Number 23 Region: 2425-2498
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000639
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 24 Region: 2081-2149
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000013
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 25 Region: 2488-2555
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000229
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 26 Region: 138-199
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000264
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 27 Region: 1908-1970
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000403
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 28 Region: 2732-2799
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000486
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 29 Region: 1384-1447
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000153
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 30 Region: 2788-2848
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000181
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 31 Region: 1209-1272
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000202
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 32 Region: 3083-3145
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000208
Family Complement control module/SCR domain 0.00077
Further Details:      
 
Domain Number 33 Region: 866-926
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000222
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 34 Region: 1557-1624
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000405
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 35 Region: 520-582
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000542
Family Complement control module/SCR domain 0.00097
Further Details:      
 
Domain Number 36 Region: 2251-2315
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000306
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 37 Region: 1734-1797
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000445
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 38 Region: 691-759
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000473
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 39 Region: 3210-3269
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000778
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 40 Region: 1039-1101
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000863
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 41 Region: 2560-2625
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000133
Family Complement control module/SCR domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016764   Gene: ENSGGOG00000017177   Transcript: ENSGGOT00000017235
Sequence length 3508
Comment pep:known_by_projection chromosome:gorGor3.1:1:34638855:35342857:-1 gene:ENSGGOG00000017177 transcript:ENSGGOT00000017235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPISIAPGPRWQVQSHHPRSAGQNCTFQLHGPNGTVESPGFPYGYPNYANCTWTITAEE
QHRIQLVFQSFALEEDFDVLSVFDGPPQPENLRTRLTGFQLPATIVSAATTLSLRLISDY
AVSAQGFHATYEVLPSHTCGNPGRLPNGIQQGSTFNLGDKVRYSCNPGFFLEGHAVLTCH
AGSENSATWDFPLPSCRADDACGGTLRGQSGIISSPHFPSEYHNNADCTWTILAELGDTI
ALVFIDFQLEDGYDFLEVTGTEGSSLWFTGASLPAPVISSKNWLRLHFTSDGNHRQRGFS
AQYQVKKQIELKSRGVKLMPSKDNSQKTSVLTQVGVSQGHNMCPDPGIPERGKRLGSDFR
LGSSVQFTCNEGYDLQGSKRITCMKVSDMFAAWSDHRPVCRARMCDAHLRGPSGIITSPN
FPIQYDNNAHCVWIITALNPAKVIKLAFEEFDLERGYDTLTVGDGGQDGDQKTVLYILTG
TSVPDLIVSTNHQMWLLFQTDGSGSSLGFKASYEEIEQGSCGDPGIPAYGRREGSRFRHG
DTLKFECQPAFELVGQKAITCQKNNQWSAKKPGCVFSCFFNFTSPSGVVLSPNYPEDYGN
HLHCVWLILARPESRIHLAFNDIDVEPQFDFLVIKDGATAEAPVLGTFSGNQLPSSITSS
GHVARLEFQTDHSTGKRGFNITFTTFRHNECPDPGVPVNGKRFGDSLQLGSSISFLCDEG
FLGTQGSETITCVLKEGSVVWNSAVLRCEAPCGGHLTSPSGTILSPGWPGFYKDALSCAW
VIEAQPGYPIKITFDRFKTEVNYDTLEVRDGRTYSAPLIGVYHGTQVPQFLISTSNYLYL
LFSTDKSHSDIGFQLRYETITLQSDHCLDPGIPVNGQRHGNDFYVGALVTFSCDSGYTLS
DGEPLECEPNFQWSRALPSCEALCGGFIQGSSGTILSPGFPDFYPNNLNCTWIIETSHGK
GVFFTFHTFHLESGHDYLLITENGSFTQPLRQLTGSRLPAPISAGLYGNFTAQVRFISDF
SMSYEGFNITFSEYDLEPCEEPEVPAYSIRKGLQFGVGDTLTFSCFPGYRLEGTAHITCL
GGRRRLWSSPLPRCVAECGNSVTGTQGTLLSPNFPVNYNNNHECIYSIQTQPGKGIQLKA
RAFELSEGDVLKVYDGNNNSARLLGVFSHSEMMGVTLNSTSSSLWLDFITDAENTSKGFE
LHFSSFELIKCEDPGTPQFGYKVHDEGHFAGSSVSFSCDPGYSLRGSEELLCLSGERRTW
DRPLPTCVAECGGTVRGEVSGQVLSPGYPAPYEHNLNCIWTIEAEAGCTIGLHFLVFDTE
EVHDVLRIWDGPVESGVLLKELSGPALPKDLHSTFNSVVLQFSTDFFTSKQGFAIQFSVS
TATSCNDPGIPQNGSRSGDSWEAGDSTVFQCDPGYTLQGSAEISCVKIENRFFWQPSPPT
CIAPCGGDLTGPSGVILSPNYPEPYPPGKECDWKVTVSPDYVIALVFNIFNLEPGYDFLH
IYDGRDSLSPLIGSFYGSQLPGRIESSSNSLFLAFRSDASVSNAGFVIDYTENPRESCFD
PGSIKNGTRVGSDLKLGSSVTYYCHGGYEVEGTSTLSCILGPDGKPVWNNPRPVCTAPCG
GQYVGSDGVVLSPNYPQNYTSGQICLYFVTVPKDYVVFGQFAFFHTALNDVVEVHDGHSQ
HSRLLSSLSGSHTGESLPLATSNQVLIKFSAKGLAPARGFHFVYQAVPRTSATQCSSVPE
PRYGKRLGSDFSVGAIVRFECNSGYALQGSPEIECLPVPGALAQWNVSAPTCVVPCGGNL
TERRGTILSPGFPEPYLNSLNCVWKIVVPEGAGIQIQVVSFVTEQNWDSLEVFDGADNTV
TMLGSFSGTTVPALLNSTSNQLYLHFYSDISVSAAGFHLEYKTVGLSSCPEPAVPSNGVK
TGERYLVNDVVSFQCEPGYALQGHAHISCMPGTVRRWNYPPPLCIAQCGGTVEEMEGVIL
SPGFPGNYPSNMDCSWKIALPVGFGAHIQFLNFSTEPNHDYIEIRNGPYETSRMMGRFSG
SELPSSLLSTSHETTVYFHSDHSQNRPGFKLEYQAYELQECPDPEPFANGIVRGAGYNVG
QSVTFECFPGYQLTGHPVLTCQHGTNRNWDHPLPKCEVPCGGNITSSNGTVYSPGFPSPY
SSSQDCVWLITVPIGHGVRLNLSLLQTEPSGDFITIWDGPQQTAPRLGVFTRSMAKKTVQ
SSSNQVLLKFHRDAATGGIFAIAFSAYPLTKCPPPTILPNAEVVTENEEFNIGDIVRYRC
LPGFTLVGNEILTCKLGTYLQFEGPPPICEVHCPTNELLTDSTGVILSQSYPGSYPQFQT
CSWLVRVEPDYNISLTVEYFLSEKQYDEFEIFDGPSGQSPLLKALSGNYSAPLIVTSSSN
SVYLRWSSDHAYNRKGFKIRYSAPYCSLPRAPLHGFILGQTSTQPGGSIHFGCNAGYRLV
GHSMAICTRHPQGYHLWSEAIPLCQALSCGLPEAPKNGMVFGKEYTVGTKAVYSCSEGYH
LQAGAEATAECLDTGLWSNRNVPPQCVPVTCPDVSSISVEHGRWRLILETQYQFQAQLML
ICDPGYYYTGQRVIRCQANGKWSLGDSTPTCRIISCGELPIPPNGHRIGTLSVYGATAIF
SCNSGYTLVGSRVRECMANGLWSGSEVRCLAITCGHPGNPINGLTQGNQFNLNDVVKFVC
NPGYMAEGAARSQCLASGQWSDMLPTCRIINCTDPGHQENSVRQVHASGPHRFSFGTTVS
YRCNHGFYLLGTSVLSCQGDGTWDRPRPQCLLVSCGHPGSPPHSQMSGDSYTVGAVVRYS
CIGKRTLVGNSTRMCGLDGHWTGSLPHCSGTSVGVCGDPGIPAHGIRLGDSFDPGTVMRF
SCEAGHMLRGSSERTCQANGSWSGSQPECGVISCGNPGTPSNARVVFSDGLVFSSSIVYE
CREGYYATGLLSRHCSVNGTWTGSDPECLVINCGDPGIPANGLRLGNDFRYNKTVTYQCV
PGYMMESHRVSVLSCTKDRTWNGTKPVCKALMCKPPPLIPNGKVVGSDFMWGSSVTYACL
EGYQLSLPAVFTCEGNGSWTGELPQCFPVFCGDPGVPPRGRREDRGFSYRSSVSFSCHPP
LVLVGSPRRFCQSDGTWSGTQPSCIDPTLTTCADPGVPQFGIQNNSQGYQVGSTVLFRCQ
KGYLLQGSTTRTCLPNLTWSGTPPDCVPHHCRQPETPTHANVGALDLPSMGYTLIYSCQE
GFSLKGGSEHRTCKADGSWTGKPPICLEVRPSGRPINTAREPPLTQALIPGDVFAKNSLW
KGAYEYQGKKQPAMLRVTGFQVANSKVNATMIDHSGVELHLAGTYKKEDFHLLLQVYQIT
GPVEIFMNKFKDDHWALDGHVSSESSGATFIYQGSVKGQGFGQFGFQRLDLRLLESDPES
IGRHFASNSSSVAAAILVPFIALIIAGFVLYLYKHRRRPKVPFNGYAGHENTNVRATFEN
PMYDRNIQPTDIMASEAEFTVSTVCTAV
Download sequence
Identical sequences ENSGGOP00000016764 ENSGGOP00000018616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]