SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016797 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016797
Domain Number 1 Region: 1011-1350
Classification Level Classification E-value
Superfamily NHL repeat 3.14e-23
Family NHL repeat 0.0018
Further Details:      
 
Domain Number 2 Region: 1319-1339,1366-1508
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0000000242
Family All0351-like 0.089
Further Details:      
 
Domain Number 3 Region: 706-777
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000049
Family Pre-dockerin domain 0.069
Further Details:      
 
Domain Number 4 Region: 415-440
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000563
Family EGF-type module 0.04
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000016797
Domain Number - Region: 545-570
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000206
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 448-474
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000365
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 515-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000761
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 581-616
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00145
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 381-408
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00426
Family Integrin beta EGF-like domains 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016797   Gene: ENSGGOG00000011659   Transcript: ENSGGOT00000025782
Sequence length 2551
Comment pep:known_by_projection chromosome:gorGor3.1:unplaced:67825038:68075468:-1 gene:ENSGGOG00000011659 transcript:ENSGGOT00000025782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPPPLSHAHTPNQHHAASINSLNRGNFTPRSNPSPAPTDHSLSGEPPAGGAQEPAHAQDN
WLLNSNIPLETRHFLFKPGGTSPLFCTTSPGYPLTSSTVYSPPPRPLPRSTFARPAFNLK
KPSKYCNWKCAALSAIVISATLVILLAYFVAMHLFGLNWHLQPMEGQMYEITEDTASSWP
VPTDVSLYPSGGTGLETPDSYKALKEIRSLNRSQIYLKSLTLMKLVCGLFRNWRCSVMLK
MHSPRYISVQKVFNSDTILKSHQLRLPPTHKQFDFVELLDGRRLLTQEARSLEGTPRQSR
GTVPPSSHETGFIQYLDSGIWHLAFYNDGKESEVVSFLTTAIESVDNCPSNCYGNGDCIS
GTCHCFLGFLGPDCGRASCPVLCSGNGQYMKGRCLCHSGWKGAECDVPTNQCIDVACSNH
GTCITGTCICNPGYKGESCEEVDCMDPTCSGRGVCVRGECHCSVGWGGTNCETPRATCLD
QCSGHGTFLPDTGLCSCDPSWTGHDCSIEICAADCGGHGVCVGGTCRCEDGWMGAACDQR
ACHPRCAEHGTCRDGKCECSPGWNGEHCTIAHYLDRVVKEGCPGLCNGNGRCTLDLNGWH
CVCQLGWRGAGCDTSMETACGDSKDNDGDGLVDCMDPDCCLQPLCHINLLCLGSPNPLDI
IQETQVPVSQQNLHSFYDRIKFLVGRDSTHIIPGENPFDGGHACVIRGQVMTSDGTPLVG
VNISFVNNPLFGYTISRQDGSFDLVTNGGISIILRFERAPFITQEHTLWLPWDRFFVMET
IIMRHEENEIPSCDLSNFARPNPVVSPSPLTSFASSCAEKGPIVPEIQALQEEISISGCK
MRLSYLSSRTPGYKSVLRISLTHPTIPFNLMKVHLMVAVEGRLFRKWFAAAPDLSYYFIW
DKTDVYNQKVFGLSEAFVSVGYEYESCPDLILWEKRTAVLQGYEIDASKLGGWSLDKHHA
LNIQSGILHKGNGENQFVSQQPPVIGSIMGNGRRRSISCPSCNGLADGNKLLAPVALTCG
SDGSLYVGDFNYIRRIFPSGNVTNILELRNKDFRHSHSPAHKYYLTTDPMSGAVFLSDSS
SRRVFKIKSTVVVKDLVKNSEVVAGTGDQCLPFDDTRCGDGGKATEATLTNPRGITVDKF
GLIYFVDGTMIRRIDQNGIISTLLGSNDLTSARPLSCDSVMDISQVHLEWPTDLAINPMD
NSLYVLDNNVVLQISENHQVRIIAGRPMHCQVPGIDHFLLSKVAIHATLESATALAVSHN
GVLYIAETDEKKINRIRQVTTSGEISLVAGAPSGCDCKNDANCDCFSGDDGYAKDAKLNT
PSSLAVCADGELYVADLGNIRIRFIRKNKPFLNTQNMYELSSPIDQELYLFDTTGKHLYT
QSLPTGDYLYNFTYTGDGDITLITDNNGNMVNVRRDSTGMPLWLVVPDGQVYWVTMGTNS
ALKSVTTQGHELAMMTYHGNSGLLATKSNENGWTTFYEYDSFGRLTNVTFPTGQVSSFRS
DTDSSVHVQVETSSKDDVTITTNLSASGAFYTLLQDQVRNSYYIGADGSLRLLLANGMEV
ALQTEPHLLAGTVNPTVGKRNVTLPIDNGLNLVEWRQRKEQARGQVTVFGRRLRVHNRNL
LSLDFDRVTRTEKIYDDHRKFTLRILYDQAGRPSLWSPSSRLNGVNVTYSTGGHIAGIQR
GIMSERMEYDQAGRITSRIFADGKTWSYTYLEKSMVLLLHSQRQYIFEFDKNDRLSSVTM
PNVARQTLETIRSVGYYRNIYQPPEGNASVIQDFTEDGHLLHTFYLGTGRRVIYKYGKLS
KLAETLYDTTKVSFTYDETAGMLKTINLQNEGFTCTIRYRQIGPLIDRQIFRFTEEGMVN
ARFDYNYDNSFRVTSMQAVINETPLPIDLYRYDDVSGKTEQFGKFGVIYYDINQIITTAV
MTHTKHFDAYGRMKEVQYEIFRSLMYWMTVQYDNMGRVVKKELKVGPYANTTRYSYEYDA
DGQLQTVSINDKPLWRYSYDLNGNLHLLSPGNSARLTPLRYDIRDRITRLGDVQYKMDED
GFLRQRGGDIFEYNSAGLLIKAYNRAGSWSVRYRYDGLGRRVSSKSSHSHHLQFFYADLT
NPTKVTHLYNHSSSEITSLYYDLQGHLFAMELSSGDEFYIACDNIGTPLAVFSGTGLMIK
QILYTAYGEIYMDTNPNFQIIIGYHGGLYDPLTKLVHMGRRDYDVLAGRWTSPDHELWKH
LSSSNVMPFNLYMFKNNNPISNSQDIKCFMTDVNSWLLTFGFQLHNVIPGYPKPDMDAME
PSYELIHTQMKTQEWDNSKSILGVQCEVQKQLKAFVTLERFDQLYGSTITSCQQAPKTKK
FASSGSVFGKGVKFALKDGRVTTDIISVANEDGRRVAAILNNAHYLENLHFTIDGVDTHY
FVKPGPSEGDLAILGLSGGRRTLENGVNVTVSQINTVLNGRTRRYTDIQLQYGALCLNTR
YGTTLDEEKARVLELARQRAVRQAWAREQQRLREGEEGLRAWTEGEKQQMLSTGRVQGYD
GFFVISVEQYPELSDSANNIHFMRQSEMGRR
Download sequence
Identical sequences ENSGGOP00000016797 ENSGGOP00000011386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]