SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016810 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016810
Domain Number 1 Region: 1-145
Classification Level Classification E-value
Superfamily Globin-like 4.23e-42
Family Globins 0.000000689
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016810   Gene: ENSGGOG00000027953   Transcript: ENSGGOT00000028748
Sequence length 145
Comment pep:novel chromosome:gorGor3.1:16:210786:211490:1 gene:ENSGGOG00000027953 transcript:ENSGGOT00000028748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLSPADKTNVKEILGPWVKALPYAGDHIAEALERMFLSFPTTKTYFPHFDLSHGSAQVK
GHGKKVAKALTNAVEHLDDMPNALSALSDLHAHKLRVDPVNFKLLNHCLLVTLAANFPSQ
FTPAVHASVDKFLASVSTVLTSKYR
Download sequence
Identical sequences G3RNU8
ENSGGOP00000016810 XP_004056906.1.27298 ENSGGOP00000026714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]