SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016829 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016829
Domain Number 1 Region: 140-261
Classification Level Classification E-value
Superfamily R3H domain 4.05e-41
Family R3H domain 0.00000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016829   Gene: ENSGGOG00000008156   Transcript: ENSGGOT00000032500
Sequence length 1081
Comment pep:known_by_projection chromosome:gorGor3.1:2b:22630375:22826311:1 gene:ENSGGOG00000008156 transcript:ENSGGOT00000032500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMSDTVTVKDETATMKDLEAEVKDTTRVENLIKSENYGKILVEKNEHCIENNIDLQRPL
QSFGQTGKRSKSSSKLKLVRSLAVCEESPPPPAPEISQENQEKIQIQLTQSFEKEEKPSK
DEAEKEKASDKLPRKMLSRDSSQEYTDSTGIDLHEFLVNTLKNNPRDRMMLLKLEQEILD
FIGNNESPRKKFPPMTSYHRMLLHRVAAYFGLDHNVDQSGKSVIVNKTSNTRIPDQKFNE
HIKDDKGEDFQKRYILKRDNSSFDKDDNQMRIRLKDDRRSKSIEEREEEYQRARDRIFSQ
DSLCSQENYIIDKRLQDEDASSTQQRRQIFRVNKDASGRSTNSHQSSTENELKYSEPRPW
SSTDSDSSLRNLKPAVTKASSFSGISVLTRGDSSGSSKSIGRLSKTGSESSGSVGSSTGS
LSHIQQPLPGTALSQSSHGAPVVYPTVSTHSSLSFDGGLNGQVASPSTSFFLLPLEAAGI
PPGSILINPQTGQPFINPDGSPVVYNPPMTQQPVRSQVPGPPQPPLPAPPQQPAANHIFS
QQDNLGSQFSHMSLARQPSADGSDPHAAMFQSTVVLQSPQQSGYIMTAAPGQPVPTAGYP
ASGHPVSQPVLQQQGYIQQPSPQMPACYCTPGHYHSSQPQYRPVPSVHYNSHLNQPLPQP
AQQTGYQVIPNQQQNYQGIVGVQQPQNQSLVSGQPNMYSMPVHSLVVPYFYLVLPEVSLP
QGSQGIPHQTYQQPVMFPNQSNQGSVPTTGMPVYYSVIPPGQQNNLSSSVGYLQHPGSEQ
VQFPRTTSPCSSQQLQGHQCTAGPPPPPGGGMVMMQLSLPNNPQSCAHSPPQWKQNKYYC
DHQRGQKCVEFSSVDSIVQHSPQLSSPIISPAQSPAPAQLSTLKTVRPSGPPLSIMPQFS
RPFVPGQGDSRYPLLGQPLQYNPPAVLHGHIPNQQGQPGSRHGNRGRRQAKKAASTDLGA
GETVVGKVLEITELPDGITRMEAEKLFGELFKIGAKIRWLRDPQSQPRRHPLCCGSGDNT
VNPERSKPSDLASTYTVLATFPSISAAQNALKKQINSVNKFKLRTSKKHYDFHILERASS
Q
Download sequence
Identical sequences ENSGGOP00000016829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]