SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016833 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016833
Domain Number 1 Region: 137-248
Classification Level Classification E-value
Superfamily C-type lectin-like 7.7e-28
Family C-type lectin domain 0.00000312
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000016833
Domain Number - Region: 103-132
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.000118
Family Triple coiled coil domain of C-type lectins 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016833   Gene: ENSGGOG00000008948   Transcript: ENSGGOT00000024798
Sequence length 249
Comment pep:novel chromosome:gorGor3.1:10:92871103:92873904:1 gene:ENSGGOG00000008948 transcript:ENSGGOT00000024798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLCPSFPVLLLSVVTASCSKTKACADTQKTCSMITCGIPITNGPPGRDGRDRPKGEKGE
PGQGLRGLQGPPGKMGPPGNTGASGIPGPRGQKGDHGDSLVAEAKLANLERELQSLRSEL
DHTKKLQAFSLGKMSGKKLFVTNGERMPFSKVKALCAGLQATVAAPKNAEENKAIQDVAK
DTAFLGITDEATEGQFMYLMGGRLTYSNWKKDEPNDHGSGEDCVILLNNGLWNDISCASS
FIAVCEFPA
Download sequence
Identical sequences ENSGGOP00000016833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]