SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016908 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016908
Domain Number 1 Region: 3-104
Classification Level Classification E-value
Superfamily HSP20-like chaperones 6.63e-18
Family Co-chaperone p23-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016908   Gene: ENSGGOG00000022837   Transcript: ENSGGOT00000033778
Sequence length 335
Comment pep:known_by_projection chromosome:gorGor3.1:15:44824872:44852822:1 gene:ENSGGOG00000022837 transcript:ENSGGOT00000033778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQNPAISITENVLHFKAQGHGAKGDNVYEFHLEFLDLVKPEPVYKLTQRQVNITVQKKVS
QWWERLTKQEKRPLFLAPDFDRWLDESDAEMELRAKEEERLNKLRLESEGSPETLTNLRK
GYLFMYNLVQFLGFSWIFVNLTVRFCILGKESFYDTFRTVADMMYFCQMLAVVETINAAI
GVTTSPVLPSLIQLLGRNFILFIIFGTMEEMQNKAVVFFVFYLWSAVEIFRYSFYMLTCI
DMDWKVLTWLRYTLWIPLYPLGCLAEAVSVIQSIPIFNETGRFSFTLPYPVKIKVRFSFF
LQIYLIMIFLGLYINFRHLYKQRRRRYGQKKKKIH
Download sequence
Identical sequences ENSGGOP00000016908 ENSGGOP00000016908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]