SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016926 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016926
Domain Number 1 Region: 40-289
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 9.16e-62
Family Leukotriene A4 hydrolase catalytic domain 0.00000438
Further Details:      
 
Domain Number 2 Region: 298-442
Classification Level Classification E-value
Superfamily ARM repeat 1.84e-36
Family Leukotriene A4 hydrolase C-terminal domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000016926
Domain Number - Region: 14-34
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 0.00209
Family Leukotriene A4 hydrolase N-terminal domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016926   Gene: ENSGGOG00000001484   Transcript: ENSGGOT00000034350
Sequence length 494
Comment pep:known_by_projection chromosome:gorGor3.1:2b:130009502:130020439:1 gene:ENSGGOG00000001484 transcript:ENSGGOT00000034350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSATRSAYMEEEGVFHFHMEHPVPAYLVALVAGDLKPADIGPRSRVWAEPCLLPTATSKL
SGAVEQWLSAAERLYGPYMWGRYDIVFLPPSFPIVAMENPCLTFIISSILESDEFLVIDV
IHEVAHSWFGNAVTNATWEEMWLSEGLATYAQRRITTETYGAAFTCLETAFRLDALHRQM
KLLGEDSPVSKLQVKLEPGVNPSHLMNLFTYEKGYCFVYYLSQLCGDPQRFDDFLRAYVE
KYKFTSVVAQDLLDSFLSFFPELKEQSVDCRAGLEFERWLNATGPPLAEPDLSQGSSLTR
PVEALFQLWTAEPLDQAAASASAIDISKWRTFQTALFLDRLLDGSPLPQEVVMSLSKCYS
SLLDSMNAEIRIRWLQIVVRNDYYPDLHRVRRFLESQMSRMYTIPLYEDLCTGALKSFAL
EVFYQTQGRLHPNLRRAIQQILSQGLGSSTEPASEPSTELGKAEADTDSDAQALLLGDEA
PSSAISLRDVNVSA
Download sequence
Identical sequences ENSP00000270357 ENSP00000270357 XP_003813128.1.60992 9606.ENSP00000270357 ENSP00000403319 ENSGGOP00000016926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]