SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016964 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016964
Domain Number 1 Region: 246-314
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000221
Family RING finger domain, C3HC4 0.025
Further Details:      
 
Domain Number 2 Region: 30-53
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000785
Family CCCH zinc finger 0.0044
Further Details:      
 
Domain Number 3 Region: 60-82
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000106
Family CCCH zinc finger 0.0048
Further Details:      
 
Domain Number 4 Region: 181-206
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000314
Family CCCH zinc finger 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000016964
Domain Number - Region: 338-367
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00144
Family CCCH zinc finger 0.0045
Further Details:      
 
Domain Number - Region: 127-213
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.0425
Family Transhydrogenase domain III (dIII) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016964   Gene: ENSGGOG00000023977   Transcript: ENSGGOT00000032330
Sequence length 455
Comment pep:known_by_projection chromosome:gorGor3.1:7:138799009:138825300:-1 gene:ENSGGOG00000023977 transcript:ENSGGOT00000032330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTPIPTVTAPSLGAGGGGGGSDGSGGGWTKQVTCRYFMHGVCKEGDNCRYSHDLSDSPYS
VVCKYFQRGYCIYGDRCRYEHSKPLKQEEATATELTTKSSLAASSSLSSIVGPLVEMNTG
EAESRNSNFATVGAGSEDWVNAIEFVPGQPYCGRTAPSCTEAPLQGSVTKEESEKEQTAV
ETKKQLCPYAAVGECRYGENCVYLHGDSCDMCGLQVLHPMDAAQRSQHIKSCIEAHEKDM
ELSFAVQRSKDMVCGICMEVVYEKANPSERRFGILSNCNHTYCLKCIRKWRSAKQFESKI
IKSCPECRITSNFVIPSEYWVEEKEEKQKLILKYKEAMSNKACRYFDEGRGSCPFGGNCF
YKHAYPDGRREEPQRQKVGTSSRYRAQRRNHFWELIEERENSNPFDNDEEEVVTFELGEM
LLMLLATGGDDELTDSEDEWDLFHDELEDFYDLDL
Download sequence
Identical sequences ENSGGOP00000016964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]