SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016972 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016972
Domain Number 1 Region: 1899-2181
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.54e-105
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000112
Further Details:      
 
Domain Number 2 Region: 18-136
Classification Level Classification E-value
Superfamily Ricin B-like lectins 4.45e-18
Family Cysteine rich domain 0.029
Further Details:      
 
Domain Number 3 Region: 326-419
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000127
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 4 Region: 946-1025
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000547
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 5 Region: 1034-1114
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000136
Family Fibronectin type III 0.0034
Further Details:      
 
Domain Number 6 Region: 682-763
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000119
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 7 Region: 504-583
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000121
Family Fibronectin type III 0.0041
Further Details:      
 
Domain Number 8 Region: 1388-1468
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000182
Family Fibronectin type III 0.0038
Further Details:      
 
Domain Number 9 Region: 1572-1711,1769-1805
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000207
Family Fibronectin type III 0.0064
Further Details:      
 
Domain Number 10 Region: 1123-1201
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000023
Family Fibronectin type III 0.0036
Further Details:      
 
Domain Number 11 Region: 1300-1380
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000249
Family Fibronectin type III 0.0042
Further Details:      
 
Domain Number 12 Region: 858-939
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000073
Family Fibronectin type III 0.0033
Further Details:      
 
Domain Number 13 Region: 1210-1301
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000121
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 14 Region: 419-494
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000931
Family Fibronectin type III 0.0036
Further Details:      
 
Domain Number 15 Region: 769-859
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000445
Family Fibronectin type III 0.004
Further Details:      
 
Domain Number 16 Region: 1477-1566
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000911
Family Fibronectin type III 0.0041
Further Details:      
 
Domain Number 17 Region: 592-673
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000417
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 18 Region: 252-317
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000229
Family Fibronectin type III 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016972   Gene: ENSGGOG00000006298   Transcript: ENSGGOT00000030893
Sequence length 2215
Comment pep:known_by_projection chromosome:gorGor3.1:12:69003710:69124325:-1 gene:ENSGGOG00000006298 transcript:ENSGGOT00000030893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAEFYMVILTCLIFRNSEGFQIVHVQKQQCLFKNEKVVVGSCNRTIQNQQWMWTEDEKL
LHVKSALCLAISNSSRGPSRSAILDLCSQAPRWTCYDQEGFLEVENASLFLQKQGSRVVV
KKARKYLHSWMKIDVNKEGKLVNESLCLKKAGLGAEVSVRSTRNTAPPQIPTTFNAVPDS
LVFLIRNTTEAFIRNAAENYSQNSSERQHPNLHMTGITDTSWVLSTTQPFSRTTEETGLA
EPERCNFTLAESKASSHSVSIQWRILGSPCNFSLIYSSDTLGAALCPIFRIDNTTYGCNL
QDLQAGTIYNFKIISLDEERTVVLQTDPLPPARFGVSKEKTTSTSLHVWWTPSSGKVTSY
EVQLFDENNQKIQGVQIQESTSWNEYTFFNLTAGSKYNIAITAVSGGKRSSSVYTNGSTV
PSPVKDIGISTKANSLLISWSHGSGNVERYRLMLMDKGILVHGGVVDKHATSYAFHGLTP
GYLYNLTVMTEAAGLQNYRWKLVRTAPMEVSNLKVTNDGSLTSLKVKWQRPPGNVDSYNI
TLSHKGTIKESRVLAPWITETHFKELVPGRLYQVTVSCVSGELSAQKMAVGRTFPDKVAN
LEANNNGRMRSLVVSWSPPAGDWEQYRILLFNDSVVLLNIAVGKEETQYVMNDTGFVPGR
QYEVEVIVESGNLKNSERCQGRTVPLAVLQLRVKHANETSLSIMWQAPVAEWEKYIISLA
DRDLLLIHKSLSKDAKEFTFTDLVPGRKYMATVTSISGDLKNSSSVKGRTVPAQVTDLHV
ANQGMTSSLFTNWTQAQGDVEFYQVLLIHENVVIKNESISSEISRYSFHSLKSGSLYSVV
VTTVSGGISSRQVVVEGRTVPSSVSGVTVKNSGRNDYLSVSWLLAPGDVDNHEVTLSHDG
KVVQSLVIAKSVRECSFSSLTPGRLYTVTITTRSGKYENHSFSQERTVPDKVQGVSVSNS
ARSDYLRVSWVHATGDFDHYEVTIKNKNNFIQTKSIPKSENECVFAQLVPGRLYSVTVTT
KSGQYEASEQGNGRTIPEPVKDLTLRNRSTEDLHVTWSGANGDVDQYEIQLLFNDMKVFP
PFHLVNTATEYRFTSLTPGRQYKILVLTISGDVQQSAFIEGFTVPSAVKNIHISPNGATD
SLTVNWTPGGGDVDSYTVSAFRHSQKVDSQTIPKHVFEHTFHRLEAGEQYQIMIASVSGS
LKNQINVVGRTVPASVQGVIADNAYSSHSLTVSWQKAAGVAERYDILLLTENGILLRNTS
EPATTKQHKFEDLTPGKKYKIQILTVSGGLFSKEAQTEGRTVPAAVTDLRITENSTRHLS
FRWTASEGELSWYNIFLYNPDGNLQERAQVDPQVQSFSFQNLLQGRMYKMVIVTHSGELS
NESFIFGRTVPASVSHLRGSNRNTTDSLWFNWSPASGDFDFYELILYNPNGTKKENWKDK
DLTEWRFQGLVPGRKYMLWVVTHSGDLSNKVTAESRTAPSPPSLMSFADIANTSLAITWK
GPPDWTDYNDFELQWLPRDALTVFNPYNNRKSEGRIVYGLRPGRSYQFNVKTVSGDSWKT
YSKPIFGSVRTKPDKIQNLHCRPQNSTAIACSWIPPDSDFDGYSIECRKMDTQEVEFSRK
LEKEKSLLNIMMLVPHKRYLVSIKVQSAGMTSEVVEDSTITMIDRPPPPPPHIRVNEKDV
LISKSSINFTVNCSWFSDTNGAVKYFTVVVREADGSDELKPEQQHPLPSYLEYRHNASIR
VYQTNYFASKCAENPNSNSKSFNIKLGAEMESLGGKCDPTQQKFCDGPLKPHTAYRISIR
AFTQLFDEDLKEFTKPLYSDTFFSLPITTESEPLFGAIEGVSAGLFLIGMLVAVVALLIC
RQKVSHGRERPSARLSIRRDRPLSVHLNLGQKGFIFNYSPIKINQFEGHFMKLQADSNYL
LSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYDATRVKLSNVDDDPCSDYINASY
IPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQDS
LYYGDLILQMLSESVLPEWTIREFKICSEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQ
FVRTVRDYINRSPGAGPTVVHCSAGVGRTGTFIALDRILQQLDSKDSVDIYGAVHDLRLH
RVHMVQTECQYVYLHQCVRDVLRARKLRSEQENPLFPIYENVNPEYHRDPVYSRH
Download sequence
Identical sequences ENSGGOP00000006172 ENSGGOP00000016972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]