SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017033 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017033
Domain Number 1 Region: 254-297
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000495
Family RING finger domain, C3HC4 0.024
Further Details:      
 
Domain Number 2 Region: 187-222
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000196
Family CCCH zinc finger 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017033   Gene: ENSGGOG00000023052   Transcript: ENSGGOT00000024489
Sequence length 322
Comment pep:known_by_projection chromosome:gorGor3.1:13:81151444:81152909:-1 gene:ENSGGOG00000023052 transcript:ENSGGOT00000024489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPPSPGRTADQADQVCTFLFKKPARKGAAGLRKRPACDPEHGESSSSGDEGDTVAQPP
RVAPRPRGLHSWQKAAHGDRRGEEAAPESLGVVYRSTRSAKPVGPEDMGATADFEQDTEK
EHHTPTILKRSQRIQEALRGREHDHIHRGIHSYLRYLKPKDTSTGNSSSGMARKGPIRAP
GHLRATVRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKLGWEIERELEEGRYCICED
ENHEVGSEEEEVPFRCFICRQAFQNPVVTKCRHYFCESCALEHFRATPRCYVCDQPTGGI
FNPAKELMAKLQKLQAAEGKKR
Download sequence
Identical sequences ENSGGOP00000017033 ENSGGOP00000017033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]