SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017047 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017047
Domain Number 1 Region: 2-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.25e-22
Family DNA gyrase/MutL, second domain 0.00049
Further Details:      
 
Domain Number 2 Region: 363-442
Classification Level Classification E-value
Superfamily HMG-box 3.93e-18
Family HMG-box 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017047   Gene: ENSGGOG00000025218   Transcript: ENSGGOT00000024573
Sequence length 738
Comment pep:known_by_projection chromosome:gorGor3.1:2b:78035399:78068990:1 gene:ENSGGOG00000025218 transcript:ENSGGOT00000024573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVIWQKSRVSDHKMALMSVLGTAVMNNMESFQYHSEESQIYLSGFLPKCDADHSFTSLST
PERSFIFINSRPVHQKDILKLIRHHYNLKCLKESTRLYPVFFLKIDVPTADVDVNLTPDK
SQVLLQNKESVLIALENLMTTCYGPLPSTNSYENNKTDVSAADIVLSKTAETDVLFNKVE
SSGKNYSNVDTSIIPFQNDMHNDESGKNTDDCLNHQISIGDFGYGHCSSEVSNIDKNTKN
AFQDISMSNISWENTQTEYSKTCFISSVKHTQSENGNKDHIDESGENEEEAGLENSSEIS
ADEWSRGNTLKNSVGENIEPVKILVPEKSLPCKVSNNNYPIPEQMNLNEDSCNKKSNVID
NKSGKVTAYDLLSNRVIKKPMSASALFVQDHRPQFLIENPKTSLEDATLQIEELWKTLSE
EEKLKYEEKATKDLERYNSRMKRAIEQESQMSLKDGRKKIKPTNAWNLAQKHKLKTSLSN
QPKLDELLQSQIEKRRSQNIKMVQIPFSMKNLKINFKKQNEVDLEEKDEPCLIHNLRFPD
AWLMTSKTEVMLLNPYRVEEALLFKRLLENHKLPAEPLEKPIMLTESLFNGSHYLDVLYK
MTADDQRYSGSTYLSDPRLTANGFKIKLIPGVSITENYLEIEGMANCLPFYGVADLKEIL
NAILNRNAKEVYECRPRKVISYLEGEAVRLSRQLPMYLSKEDIQDIIYRMKHQFGNENKE
CVHGRPFFHHLTYLPETT
Download sequence
Identical sequences ENSGGOP00000017047 ENSGGOP00000017047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]