SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017069 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000017069
Domain Number - Region: 125-165
Classification Level Classification E-value
Superfamily PRP4-like 0.0536
Family PRP4-like 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017069   Gene: ENSGGOG00000025262   Transcript: ENSGGOT00000022935
Sequence length 242
Comment pep:known_by_projection chromosome:gorGor3.1:X:13909289:13932505:-1 gene:ENSGGOG00000025262 transcript:ENSGGOT00000022935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVKASTSKATRPWYSHLVYARYWQHYHQAMAWMQSHHNAYRKAVESCFNLPWYFPPAL
LPQSSYDNEAAYPQSFYDHHVAWQDYPCSSSHFRRSGQHPHYSSRIQASTKEDQALSKEE
EMETESDAEVECDLSNMEITEELRQYFAETERHREERRRQQQLDAERLDSYVNADHDLYC
NTRRSVEAPTERPGERRQAEMKRLYGDSAAKIQAMEAAVQLSFDKHCDRKQPKYWPVIPL
KF
Download sequence
Identical sequences G3RMQ4
XP_004063869.1.27298 XP_004063870.1.27298 XP_004063871.1.27298 XP_018875366.1.27298 ENSGGOP00000017069 ENSGGOP00000017069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]