SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017110 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017110
Domain Number 1 Region: 41-270
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 1.05e-46
Family Glycerol-3-phosphate (1)-acyltransferase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017110   Gene: ENSGGOG00000002319   Transcript: ENSGGOT00000026363
Sequence length 283
Comment pep:known_by_projection chromosome:gorGor3.1:6:33055500:33063435:-1 gene:ENSGGOG00000002319 transcript:ENSGGOT00000026363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLWPGAWMLLLLLFLLLLFLLPTLWFCSPSAKYFFKMAFYNGWILFLAVLAIPVCAVRG
RNVENMKILRLMLLHIKYLYGIRVEVRGAHHFPPSQPYVVVSNHQSSLDLLGMMEVLPGR
CVPIAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGT
RNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERRFTSGQCQVRVLPPVPTE
GLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPGGGG
Download sequence
Identical sequences A0A024RCV5 G3RMU5 H2QSR0 Q99943
ENSPTRP00000030753 ENSGGOP00000002281 ENSP00000337463 ENSP00000364245 ENSP00000364248 ENSP00000372782 ENSP00000378874 ENSP00000378875 ENSP00000378877 ENSP00000382721 ENSP00000382723 ENSP00000382725 ENSP00000382726 ENSP00000382728 ENSP00000387738 ENSP00000387810 ENSP00000388090 ENSP00000388253 ENSP00000388815 ENSP00000388870 ENSP00000389516 ENSP00000390988 ENSP00000392083 ENSP00000392820 ENSP00000394919 ENSP00000395613 ENSP00000395863 ENSP00000397765 ENSP00000398016 ENSP00000401287 ENSP00000401410 ENSP00000404106 ENSP00000405565 ENSP00000405864 ENSP00000406582 ENSP00000406614 ENSP00000406615 ENSP00000407189 ENSP00000408032 ENSP00000408842 ENSP00000410831 ENSP00000412304 ENSP00000412805 ENSP00000415015 NP_006402.1.87134 NP_006402.1.92137 NP_116130.2.87134 NP_116130.2.92137 XP_001164116.1.37143 XP_004043795.1.27298 XP_005248863.1.92137 XP_011512536.1.92137 XP_016810716.1.37143 XP_016810717.1.37143 ENSP00000337463 ENSP00000364245 ENSP00000364248 ENSP00000372782 ENSP00000378874 ENSP00000378875 ENSP00000378877 ENSP00000382721 ENSP00000382723 ENSP00000382725 ENSP00000382726 ENSP00000382728 ENSP00000387738 ENSP00000387810 ENSP00000388090 ENSP00000388253 ENSP00000388815 ENSP00000388870 ENSP00000389516 ENSP00000390988 ENSP00000392083 ENSP00000392820 ENSP00000394919 ENSP00000395613 ENSP00000395863 ENSP00000397765 ENSP00000398016 ENSP00000401287 ENSP00000401410 ENSP00000404106 ENSP00000405565 ENSP00000405864 ENSP00000406582 ENSP00000406614 ENSP00000406615 ENSP00000407189 ENSP00000408032 ENSP00000408842 ENSP00000410831 ENSP00000412304 ENSP00000412805 ENSP00000415015 ENSPTRP00000030753 ENSGGOP00000017110 ENSP00000337463 ENSP00000372782 ENSP00000387738 ENSP00000387810 ENSP00000388253 ENSP00000388815 ENSP00000392820 gi|15100175|ref|NP_116130.2| gi|5453718|ref|NP_006402.1| 9598.ENSPTRP00000030753 9606.ENSP00000337463 9606.ENSP00000382723 9606.ENSP00000389516 9606.ENSP00000395863 9606.ENSP00000401287 9606.ENSP00000405864 9606.ENSP00000412805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]