SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017113 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017113
Domain Number 1 Region: 1067-1331
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 9.02e-87
Family BC ATP-binding domain-like 0.0000114
Further Details:      
 
Domain Number 2 Region: 574-793
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 9.02e-51
Family BC ATP-binding domain-like 0.0000195
Further Details:      
 
Domain Number 3 Region: 788-947
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 8.76e-49
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.00013
Further Details:      
 
Domain Number 4 Region: 192-400
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 3.57e-47
Family Class I glutamine amidotransferases (GAT) 0.0000461
Further Details:      
 
Domain Number 5 Region: 45-195
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, small subunit N-terminal domain 5.23e-47
Family Carbamoyl phosphate synthetase, small subunit N-terminal domain 0.0000992
Further Details:      
 
Domain Number 6 Region: 949-1068
Classification Level Classification E-value
Superfamily PreATP-grasp domain 7.19e-39
Family BC N-terminal domain-like 0.000034
Further Details:      
 
Domain Number 7 Region: 419-534
Classification Level Classification E-value
Superfamily PreATP-grasp domain 6.62e-31
Family BC N-terminal domain-like 0.0000991
Further Details:      
 
Domain Number 8 Region: 1339-1474
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 1.31e-26
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017113   Gene: ENSGGOG00000028226   Transcript: ENSGGOT00000024159
Sequence length 1479
Comment pep:known_by_projection chromosome:gorGor3.1:2b:99271084:99392144:1 gene:ENSGGOG00000028226 transcript:ENSGGOT00000024159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRILTAFKVVRTLKTGFGFTNVTAHQKWKFSRPGIRLLSVKAQTAHIVLEDGTKMKGYS
FGHPSSVAGEVVFNTGLGGYPEAITDPAYKGQILTMANPIIGNGGAPDTTALDELGLSKY
LESNGIKVAGLLVLDYSKDYNHWLATKSLGQWLQEEKVPAIYGVDTRMLTKIIRDKGTML
GKIEFEGQPVDFVDPNKQNLIAEVSTKDVKVYGKGNPTKVVAVDCGIKNNVIRLLVKRGA
EVHLVPWNHDFTKMEYDGILIAGGPGNPALAEPLIQNVRKILESDRKEPLFGISTGNLIT
GLAAGAKTYKMSMANRGQNQPVLNITNKQAFITAQNHSYALDNALPAGWKPLFVNVNDQT
NEGIMHESKPFFAVQFHPEVTPGPTDTEYLFDSFFSLIKKGKATTITSVLPKPALVASRV
EVSKVLILGSGGLSIGQAGEFDYSGSQAVKAMKEENVKTVLMNPNIASVQTNEVGLKQAD
TVYFLPITPQFVTEVIKAERPDGLILGMGGQTALNCVSLLYRRILLFSVAIEVLRTIMNE
NIEIQTAFPFTAKPNQIYYKTMRHFSLGLSATACPKVRDYHFPILGSVFYPLWDLCQGIL
PNILVEAFAMTNQILVEKSVTGWKEIEYEVVRDADDNCVTVCNMENVDAMGVHTGDSVVV
APAQTLSNAEFQMLRHTSINVVRHLGIVGECNIQFALHPTSMEYCIIEVNARLSRSSALA
SKATGYRYVYVQPSILKNMPIKQDLAKKRSLCFNLEFLILILWSRAGTGLKHVLQVMAIG
RTFEESFQKALRMCHPSIEGFTPRLPMNKEWPSNLDLRKELSEPSSTRIYAIAKAIDDNM
SLDEIEKLTYIDKWFLYKMRDILNMEKTLKGLNSESVTEETLKRAKEIGFSDKQISKCLG
LTEAQTRELRLKKNIHPWVKQIDTLAAEYPSVTNYLYVTYNGQEHDVNFDDHGMMVLGCG
PYHIGSSSVEFDWCAVSSIRTLRQLGKKTVVVNCNPETVSTDFDECDKLYFEELSLERIL
DIYHQEACGGCIISVGGQIPNNLAVPLYKNGVKIMGTSPLQIDRAEDRSIFSAVLDELKV
AQAPWKAVNTLNEALEFAKSVDYPCLLRPSYVLSGSAMNVVFSEDEMKKFLEEATRVSQE
HPVVLTKFVEGAREVEMDAVGKDGRVISHAISEHVEDAGVHSGDATLMLPTQTISQGAIE
KVKDATRKIAKAFAISGPFNVQFLVKGNDVLVIECNLRASRSFPFVSKTLGVDFIDVATK
VMIGENVDEKPLPTLDHPIIPADYVAIKAPMFSWPRLRDADPILRCEMASTGEVACFGEG
IHTAFLKAMLSTGFKIPQKGILIGIQQSFRPRFLGVAEQLHNEGFKLFATEATSDWLNAN
NVPATPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGI
PLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQYGAGKAA
Download sequence
Identical sequences ENSGGOP00000017113 ENSGGOP00000017113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]