SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017166 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017166
Domain Number 1 Region: 519-597
Classification Level Classification E-value
Superfamily PDZ domain-like 2.89e-21
Family PDZ domain 0.0042
Further Details:      
 
Domain Number 2 Region: 35-110
Classification Level Classification E-value
Superfamily HR1 repeat 9.02e-21
Family HR1 repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017166   Gene: ENSGGOG00000005716   Transcript: ENSGGOT00000026122
Sequence length 662
Comment pep:known_by_projection chromosome:gorGor3.1:8:143544094:143558541:1 gene:ENSGGOG00000005716 transcript:ENSGGOT00000026122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSAAGAAMILEERPDGAGAGEESPRLQEEAGVRNGSRGCDSLTQIQCGQLQSRRAQIHQQ
IDKELQMRTGAENLYRATSNNWVRETVALELSYVNSNLQLLKEELEELSGGVDPGRHGSE
AVTVPMIPLGLKETKELDWSTPLKELISVHFGEDGASYEAEIGELEALRQAMRTPSRNES
GLELLTAYYNQLCFLDARFLTPARSLGLFFHWYDSLTGVPAQQRALAFEKGSVLFNIGAL
HTQIGARQDRSCAEGARRAMEAFQRAAGAFSLLRENFSHAPSPDMSAASLCALEQLMMAQ
AQECVFEGLSPPASMAPQDCLAQLRLAQEAAQVAAEYRLVHRTMAQPPVHDYVPVSWTAL
VHVKAEYFRSLAHYHVAMALCDGSPATEGELPTHEQVFLQPPTSSKPRGPVLPQELEERR
QLGKAHLKRAILGQEEALRLHALCRVLREVDLLRAVISQTLQRSLAKYAELDREDDFCEA
AEAPDIQPKTHQKPEARMPRLSQGRGPDIFHRLGPLSVFSAKNRWRLVGPVHLTRGEGGF
GLTLRGDSPVLIAAVIPGSQAAAAGLKEGDYIVSVNGQPCRWWRHAEVVTELKAAGEAGA
SLQVVSLLPSSRLPSLGPRGLLRSQREHGCKTPASTGASPRPLLNWSRKAQQGKTGGCPQ
PC
Download sequence
Identical sequences ENSGGOP00000017166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]