SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017176 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017176
Domain Number 1 Region: 80-158
Classification Level Classification E-value
Superfamily HMG-box 1.14e-21
Family HMG-box 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017176   Gene: ENSGGOG00000028441   Transcript: ENSGGOT00000029315
Sequence length 941
Comment pep:known_by_projection chromosome:gorGor3.1:3:106680468:106965724:1 gene:ENSGGOG00000028441 transcript:ENSGGOT00000029315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGSNRNKDHSAEGEGVGKRPKRKCLQWHPLLAKKLLDFSEEEEEEDEEEDIDKVQLLGA
DGLEQDVGETEDDESPEQRARRPMNAFLLFCKRHRSLVRQEHPRLDNRGATKILADWWAV
LDPKEKQKYTDMAKEYKDAFMKANPGYKWCPTTNKPVKSPTPTVNPRKKLWAFPSDSSRD
LPSPKKGKTEEMPQLNFGMADPTQMGGLSMLLLAGEHALGTPEVSSGTCRPDVSESPELR
QKSPLFQFAEISSSTSHPDASTKQCQTSALFQFAEISSNTSQLGGAEPVKRCGKSALFQL
AEMCLASEGMKMEESKLIKAKESDGGRIKELEKGKEEKEIKMEKTDETRLQKEAEFEKSA
KENVSDSKELRNFEALQIDDIMAIKMEDHKEIRKEELEEDHKCSHFPDFSYSASSKIIIS
DVPSRKDHMCHPHGIMIIEDPAALNKPEKLKKKKKKSKMDRHGNDKSTPKKTCKKRQSSE
SDIESVIYTIEAVAKGDWGIEKLGDTPRKKVRTSSSGKGSILDAKPPKKKVKSREKKMSK
EKSSDTTKESRPPDFISISASKNISGETPEGIKAEPLTPMEDALPPSLSGQAKPEDSDCH
RKIETCGSRKSERSCKGALYKTLVSEGMLTSLRANVDRGKRSSGKGNSSDHEGCWNEESW
TFSQSGTSGSKKFKKTKPKEDCLLGSAKLDEEFEKKFNSLPQYSPVTFDRKCVPVPRKKK
KTGNVSSEPTKTSKGPFQSQKKNLFHKIVSKYKHKKEKPNVPEKGSGDKWSNKQLFLDAI
HPTEAIFSEDRNATEPVHKVKNIPSIFNTPEPTTTQEPLVGSQKRKARKTKITHLVRTAD
GRVSPAGGTLDDKPKEQLQRSLSKATETDCNDECSHNTEVGETRSSTPEMPAVSAFFSLA
ALAEVAAMENVHRGQRSTPLTHDGQPKEMPQAPVLISCADQ
Download sequence
Identical sequences A0A2I2YIW9
ENSGGOP00000017176 XP_004036061.1.27298 XP_018879762.1.27298 XP_018879763.1.27298 XP_018879764.1.27298 ENSGGOP00000017176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]