SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017202 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017202
Domain Number 1 Region: 533-709
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 4.72e-49
Family Crystallins/Ca-binding development proteins 0.00012
Further Details:      
 
Domain Number 2 Region: 723-886
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 1.88e-43
Family Crystallins/Ca-binding development proteins 0.00099
Further Details:      
 
Domain Number 3 Region: 348-503
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 2.16e-33
Family Crystallins/Ca-binding development proteins 0.0016
Further Details:      
 
Domain Number 4 Region: 892-1021
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.23e-25
Family Ricin B-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017202   Gene: ENSGGOG00000016206   Transcript: ENSGGOT00000026834
Sequence length 1023
Comment pep:known_by_projection chromosome:gorGor3.1:3:96871017:96946759:1 gene:ENSGGOG00000016206 transcript:ENSGGOT00000026834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPDFQPGDTTVRLDKRMSLTAIYDKRRETDYSGDKGYNLAFVSQDEQENSSFTILYEEPL
QEEDKYASAEARQTQSVLFRDTSADSMPVLACERSESRTDLVHHFEKGTKLGETFDSDSS
EMFLSVEAKRYKIYPLALSPIYEDDSSQEDILSSEVSPGHHGPRKSGESENQSSSVLSLL
QSVSERLKMNFDEDDREAADEEEEEEEAVVLHKGGLRAGGGEHVTLQLPDPSITFYPDDQ
ESIGISKNSYVMPNEPTTSNLQVGLWPEKTSFLQKSDLTSKLHSSLKSVYHQYLQTSQSH
SSEKGARFGGIFQEPVSKYFRVQDNPVRLSPFIENVDKQTLRCNPRPGKMVIYDLHESTY
KQEVYCNIPDATSWSFPNGVLIKVVRGCWILYEKPHFRGQKCVLEEGEKVLNCDWVLQNR
RHPQRNFILGSLKRVLKDCSIPEIELFPQSDPACCPVYIQRAVPNLEELNISKSMSFTVK
SGVWLAYPDINFKGQATVLEEDYGLFEISTAEMKSLHPLQMGGLKVEMPMNLKVIIYEKP
HFHGQAKEFSEHIDSVPKFLKNNGDFHRIGSIRVIGGVWVAYEKEHFKGQQFLLEEGDFE
DSNACGALSGPILSFRYLQANFIESSVTLFESDLESGKFIDITNQEISDLEEIGFGSKTR
SIHVKSGVWVAYQQKFFCGEQYILEKGKYKCFFDWGGSNNIIMSIRPIQLEPLGINEPLH
LLKAFSKPGFQSECIDFTEETSDLTSLMPCSFKVLRGCWLLYYQEDMFVNHCVLEEGLYA
DLTSCGCPASKVKSLKPIDYVFEEPSISLFALEHCEGRELHLEEAVNSVLNKDLHFYTQS
VWVKSGLWIAYEGSNFLGRQILLRPNEIPNWTAFSRWKTIGSLRPMKQPAVYIRIKNRAQ
GEYLTVTGSLADTRATSVCISPYSGKNTQIWYYCRGLFKSKASDTCLDVIGGRDTPGAKV
ALWTEHGQFRQKWRLNKNGTISSYLSDQLVLDVKGGNYCDKTHVIVNQPLEGEETQKWDI
EIL
Download sequence
Identical sequences ENSGGOP00000015818 ENSGGOP00000015818 ENSGGOP00000017202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]