SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017218 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017218
Domain Number 1 Region: 214-488
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-84
Family Protein kinases, catalytic subunit 0.00000176
Further Details:      
 
Domain Number 2 Region: 93-206
Classification Level Classification E-value
Superfamily SMAD/FHA domain 9.18e-31
Family FHA domain 0.00000037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017218   Gene: ENSGGOG00000023242   Transcript: ENSGGOT00000033113
Sequence length 488
Comment pep:known_by_projection chromosome:gorGor3.1:22:12761397:12808579:-1 gene:ENSGGOG00000023242 transcript:ENSGGOT00000033113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMSRESDVEAQQSHGSSACSQPHGSVTQSQGSSSQSQGISSSSTSTMPNSSQSSHSSSGT
LSSLETVSTQELYSIPEDQEPEDQEPEEPTPAPWARLWALQDGFANLECVNDNYWFGRDK
SCEYCFDEPLLKRTDKYRTYSKKHFRIFREVGPKNSYIAYIEDHSGNGTFVNTELVGKGK
RRPLNNNSEIALSLSRNKVFVFFDLTVDDQSVYPKALRDEYIMSKTLGSGACGEVKLAFE
RKTCKKVAIKIISKRKFAIGSAREADPALNVETEIEILKKLNHPCIIKIKNFFDAEDYYI
VLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQE
EDCLIKITDFGHSKILGETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFI
CLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEE
ALRHPWLQ
Download sequence
Identical sequences ENSGGOP00000017218 ENSGGOP00000017218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]