SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017257 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017257
Domain Number 1 Region: 13-131
Classification Level Classification E-value
Superfamily SMAD MH1 domain 6.02e-46
Family SMAD MH1 domain 0.00000264
Further Details:      
 
Domain Number 2 Region: 259-296
Classification Level Classification E-value
Superfamily SMAD/FHA domain 8.2e-18
Family SMAD domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017257   Gene: ENSGGOG00000022121   Transcript: ENSGGOT00000024284
Sequence length 305
Comment pep:novel chromosome:gorGor3.1:4:155704517:155747338:1 gene:ENSGGOG00000022121 transcript:ENSGGOT00000024284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQ
PSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEV
CINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPN
SHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTHDGSQ
PMDTNMMAPPLPSEINRGGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNP
ISSVS
Download sequence
Identical sequences ENSGGOP00000017257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]