SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017277 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017277
Domain Number 1 Region: 41-133
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.6e-39
Family SCAN domain 0.0000434
Further Details:      
 
Domain Number 2 Region: 285-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.43e-23
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 3 Region: 247-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.58e-21
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 327-379
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-20
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017277   Gene: ENSGGOG00000024543   Transcript: ENSGGOT00000027933
Sequence length 389
Comment pep:known_by_projection chromosome:gorGor3.1:6:29314077:29324865:-1 gene:ENSGGOG00000024543 transcript:ENSGGOT00000027933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAITLTLQTAEMQEGLLAVKVKEEEEEHSCGPESGLSRNNPHTREIFRRRFRQFCYQESP
GPREALRRLQELCHQWLRPEMHTKEQILELLVLEQFLSILPEELQAWVRQHRPVSGEEAV
TVLEDLERELDEPGEQVLSHAHEQEEFVKEKATPGAAQESSNDEFQTLEEQLGYNLREVC
QVQEIDGKAGTWNVELAPKREISQEVKSLIQVLGKQNGNITQIPEYGDTCDRDGRLEKQR
VSSSVERPYICSECGKSFTQNSILIEHQRTHTGEKPYECDECGRAFSQRSGLFQHQRLHT
GEKRYQCSVCGKAFSQNAGLFHHLRIHTGEKPYQCNQCNKSFSRRSVLIKHQRIHTGERP
YECEECGKNFIYHCNLIQHRKVHPVAESS
Download sequence
Identical sequences G3RNB1
ENSGGOP00000017277 ENSGGOP00000017277 XP_004043558.1.27298 XP_018885514.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]